DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2116 and ZNF552

DIOPT Version :9

Sequence 1:NP_572444.2 Gene:CG2116 / 31735 FlyBaseID:FBgn0030003 Length:598 Species:Drosophila melanogaster
Sequence 2:NP_079038.2 Gene:ZNF552 / 79818 HGNCID:26135 Length:407 Species:Homo sapiens


Alignment Length:167 Identity:55/167 - (32%)
Similarity:82/167 - (49%) Gaps:7/167 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   233 EDSTPLVEFSMISDIMDEKLPVECGICPDVMH-KSKLSKHHKTHLVPGTNRYACIYCTETYRDCK 296
            :.|:....||....:...:.|..||||..:.: ||.|..|.:.|  .|...|.|..|.:.:|...
Human   247 KSSSKYDSFSNHQGVHTREKPYTCGICGKLFNSKSHLLVHQRIH--TGEKPYECEVCQKFFRHKY 309

  Fly   297 YLAGHARRHMGIRPYVCELCTLYFSTKQDLRVHNQRRHLEKEHICEVCGKTFAQNTQLKRHREAT 361
            :|..|.|.|.|.|||.|..|...|:.....|||.:....:|.:.|..|||:||:::.|.:||. .
Human   310 HLIAHQRVHTGERPYECSDCGKSFTHSSTFRVHKRVHTGQKPYECSECGKSFAESSSLTKHRR-V 373

  Fly   362 HEKKRRFQCEYCQKAYYKNFSLQEHIRNVHMGKRRML 398
            |..::.:.|..|:|.:.:..||:.|.| ||  ||:.|
Human   374 HTGEKPYGCSECEKKFRQISSLRHHQR-VH--KRKGL 407

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2116NP_572444.2 C2H2 Zn finger 256..275 CDD:275368 8/19 (42%)
C2H2 Zn finger 285..305 CDD:275368 6/19 (32%)
PHA00733 <308..357 CDD:177301 17/48 (35%)
C2H2 Zn finger 313..334 CDD:275368 6/20 (30%)
C2H2 Zn finger 341..362 CDD:275368 9/20 (45%)
C2H2 Zn finger 370..388 CDD:275368 6/17 (35%)
C2H2 Zn finger 400..418 CDD:275370
C2H2 Zn finger 429..447 CDD:275368
ZNF552NP_079038.2 KRAB 14..>55 CDD:214630
KRAB 14..53 CDD:279668
C2H2 Zn finger 93..113 CDD:275368
C2H2 Zn finger 121..141 CDD:275368
C2H2 Zn finger 214..234 CDD:275368
COG5048 <243..407 CDD:227381 54/165 (33%)
C2H2 Zn finger 244..262 CDD:275368 3/14 (21%)
C2H2 Zn finger 270..290 CDD:275368 8/19 (42%)
zf-H2C2_2 282..307 CDD:290200 7/26 (27%)
C2H2 Zn finger 298..318 CDD:275368 6/19 (32%)
zf-H2C2_2 310..335 CDD:290200 11/24 (46%)
C2H2 Zn finger 326..346 CDD:275368 6/19 (32%)
zf-H2C2_2 339..362 CDD:290200 8/22 (36%)
C2H2 Zn finger 354..374 CDD:275368 9/20 (45%)
C2H2 Zn finger 382..402 CDD:275368 7/20 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 104 1.000 Inparanoid score I4954
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.