DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2116 and ZNF398

DIOPT Version :9

Sequence 1:NP_572444.2 Gene:CG2116 / 31735 FlyBaseID:FBgn0030003 Length:598 Species:Drosophila melanogaster
Sequence 2:XP_011514741.1 Gene:ZNF398 / 57541 HGNCID:18373 Length:647 Species:Homo sapiens


Alignment Length:486 Identity:114/486 - (23%)
Similarity:172/486 - (35%) Gaps:110/486 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 TDDEQMPQFVVRELDMSEVGDLVEVEPEMEQEADYGDYGDYEHEPSYGHPRDNERVEEDLDMYPP 151
            |:|:..|:......|.||       ||.: ..:|...:...|.||..|.|.::    ::.|:|..
Human   208 TEDQAGPEESEIPTDPSE-------EPGI-STSDILSWIKQEEEPQVGAPPES----KESDVYKS 260

  Fly   152 S---------SPSLPPSP--PRPPSPVVQPASKARNSARQIALRSFVSQKNNDDDDGSVKEVKPS 205
            :         :..|..|.  |..|.|...|.:.|:::...:|.:|  .|..:....|     :|:
Human   261 TYADEELVIKAEGLARSSLCPEVPVPFSSPPAAAKDAFSDVAFKS--QQSTSMTPFG-----RPA 318

  Fly   206 EKMLEEFKGPRRYM------------------------LFDDLIAT------------IVDFDED 234
            ..:.|..:|...:.                        |..|::.|            .....:.
Human   319 TDLPEASEGQVTFTQLGSYPLPPPVGEQVFSCHHCGKNLSQDMLLTHQCSHATEHPLPCAQCPKH 383

  Fly   235 STPLVEFSMISDIMDEKLPVECGICPDVM-HKSKLSKHHKTHLVPGTNR-YACIYCTETYRDCKY 297
            .||..:.|..|.....:.|..|..|.... |.|:|:.|.:.|  ..|.| :.|..|.:.:.|...
Human   384 FTPQADLSSTSQDHASETPPTCPHCARTFTHPSRLTYHLRVH--NSTERPFPCPDCPKRFADQAR 446

  Fly   298 LAGHARRHMGIRPYVCELCTLYFSTKQDLRVHNQRRHLEKEHICEVCGKTFAQNTQLKRHREATH 362
            |..|.|.|...||:.|..|...||.|..|.:|.:....|:...|..||..|..::.|.|| :..|
Human   447 LTSHRRAHASERPFRCAQCGRSFSLKISLLLHQRGHAQERPFSCPQCGIDFNGHSALIRH-QMIH 510

  Fly   363 EKKRRFQCEYCQKAYYKNFSLQEHIRNVHMGKRRMLKCPFCGMQCRDAHKMARHRKEMHLSQGTY 427
            ..:|.:.|..|.|::.:...|..| |.:|.|: |...||.||......|.:.:|:: :|..:..|
Human   511 TGERPYPCTDCSKSFMRKEHLLNH-RRLHTGE-RPFSCPHCGKSFIRKHHLMKHQR-IHTGERPY 572

  Fly   428 VCHLCQEEFTDISYFDAHKRSIQCRSNTRRFVNADGNREGSDSESISGRNMNGQDDDYDGM---- 488
            .|..|...|........|.||              |:..|.           |.|.|..|.    
Human   573 PCSYCGRSFRYKQTLKDHLRS--------------GHNGGC-----------GGDSDPSGQPPNP 612

  Fly   489 -GPLQEEYDEDDGLLV-----EDNQPEEQGS 513
             |||.... |..||.|     |.||...:||
Human   613 PGPLITGL-ETSGLGVNTEGLETNQWYGEGS 642

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2116NP_572444.2 C2H2 Zn finger 256..275 CDD:275368 6/19 (32%)
C2H2 Zn finger 285..305 CDD:275368 6/19 (32%)
PHA00733 <308..357 CDD:177301 15/48 (31%)
C2H2 Zn finger 313..334 CDD:275368 7/20 (35%)
C2H2 Zn finger 341..362 CDD:275368 7/20 (35%)
C2H2 Zn finger 370..388 CDD:275368 5/17 (29%)
C2H2 Zn finger 400..418 CDD:275370 6/17 (35%)
C2H2 Zn finger 429..447 CDD:275368 4/17 (24%)
ZNF398XP_011514741.1 DUF3669 62..117 CDD:289202
KRAB 148..206 CDD:214630
KRAB_A-box 148..187 CDD:143639
COG5048 <349..593 CDD:227381 64/249 (26%)
C2H2 Zn finger 377..397 CDD:275368 4/19 (21%)
C2H2 Zn finger 405..425 CDD:275368 6/19 (32%)
C2H2 Zn finger 434..454 CDD:275368 6/19 (32%)
C2H2 Zn finger 462..482 CDD:275368 7/19 (37%)
C2H2 Zn finger 490..510 CDD:275368 7/20 (35%)
zf-H2C2_2 502..525 CDD:290200 8/23 (35%)
C2H2 Zn finger 518..538 CDD:275368 6/20 (30%)
zf-H2C2_2 530..555 CDD:290200 10/26 (38%)
zf-C2H2 544..566 CDD:278523 6/22 (27%)
C2H2 Zn finger 546..566 CDD:275368 6/20 (30%)
zf-H2C2_2 558..583 CDD:290200 6/25 (24%)
C2H2 Zn finger 574..592 CDD:275368 4/17 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 104 1.000 Inparanoid score I4954
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.