DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2116 and Sry-beta

DIOPT Version :9

Sequence 1:NP_572444.2 Gene:CG2116 / 31735 FlyBaseID:FBgn0030003 Length:598 Species:Drosophila melanogaster
Sequence 2:NP_001303451.1 Gene:Sry-beta / 43570 FlyBaseID:FBgn0003511 Length:356 Species:Drosophila melanogaster


Alignment Length:286 Identity:60/286 - (20%)
Similarity:101/286 - (35%) Gaps:59/286 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   169 QPASKAR------NSARQIALRSFVSQKNNDDDDGSVKEVKPSEKMLEEFKGPRRYMLFDDLIAT 227
            |.|.:||      ...:..||:....|...:|:   .:|....|.:.|||:       |.:    
  Fly   102 QAAKRARVQVPAFKIVQATALKEPERQPGEEDE---CEEFMKEEMLDEEFQ-------FSE---- 152

  Fly   228 IVDFDEDSTPLVEFSMISDIMDEKLPVECGICPDVMHKSK-LSKHHKTHLVPGTNRYACIYCTET 291
                .:||.|..|    .:...|...:.|.||.::....: |.:|.|......:.:..|..|...
  Fly   153 ----PDDSMPSSE----EEFFTETTEIPCHICGEMFSSQEVLERHIKADTCQKSEQATCNVCGLK 209

  Fly   292 YRDCKYLAGHARRHMGIRPYVCELCTLYFSTKQDLRVHNQRRHLEKEHICEVCGKTFAQNTQLKR 356
            .:|.:.|..|                        :.:|..:..||    |..|.|.|:....:.|
  Fly   210 VKDDEVLDLH------------------------MNLHEGKTELE----CRYCDKKFSHKRNVLR 246

  Fly   357 HREATHEKKRRFQCEYCQKAYYKNFSLQEHIRNVHMGKRRMLKCPFCGMQCRDAHKMARHRKEMH 421
            |.| .|..|:::||:.|.:.:..::.:..|:.. |..:...|.|..|..|.:.......|.:...
  Fly   247 HME-VHWDKKKYQCDKCGERFSLSWLMYNHLMR-HDAEENALICEVCHQQFKTKRTYKHHLRTHQ 309

  Fly   422 LSQGTYVCHLCQEEFTDISYFDAHKR 447
            ..:..|.|..|::.|.|......|||
  Fly   310 TDRPRYPCPDCEKSFVDKYTLKVHKR 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2116NP_572444.2 C2H2 Zn finger 256..275 CDD:275368 6/19 (32%)
C2H2 Zn finger 285..305 CDD:275368 5/19 (26%)
PHA00733 <308..357 CDD:177301 7/48 (15%)
C2H2 Zn finger 313..334 CDD:275368 1/20 (5%)
C2H2 Zn finger 341..362 CDD:275368 7/20 (35%)
C2H2 Zn finger 370..388 CDD:275368 3/17 (18%)
C2H2 Zn finger 400..418 CDD:275370 4/17 (24%)
C2H2 Zn finger 429..447 CDD:275368 5/17 (29%)
Sry-betaNP_001303451.1 C2H2 Zn finger 203..223 CDD:275368 5/43 (12%)
C2H2 Zn finger 231..251 CDD:275368 7/20 (35%)
C2H2 Zn finger 259..308 CDD:275368 9/49 (18%)
C2H2 Zn finger 288..303 CDD:275370 3/14 (21%)
zf-C2H2 315..337 CDD:278523 8/21 (38%)
C2H2 Zn finger 317..337 CDD:275368 7/19 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449761
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.