DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2116 and CG31365

DIOPT Version :9

Sequence 1:NP_572444.2 Gene:CG2116 / 31735 FlyBaseID:FBgn0030003 Length:598 Species:Drosophila melanogaster
Sequence 2:NP_732827.1 Gene:CG31365 / 42736 FlyBaseID:FBgn0051365 Length:639 Species:Drosophila melanogaster


Alignment Length:540 Identity:124/540 - (22%)
Similarity:188/540 - (34%) Gaps:152/540 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 VLPANSDYSDEDN---RGNVRVINTSDDATYVLLDNLGNEFEEDIIIVNENGVE--KEMLMSK-E 73
            |...:.|..|||.   ..::..|...|....:..:....:|:|      |...|  |.::.|: |
  Fly    99 VFSKDPDDYDEDELEFEDSIAFIEVQDKVRKLEDEKWREDFKE------EQAAEMHKRLVKSRLE 157

  Fly    74 LRDFIVGSRVKDLTDDEQMPQFVVRELD---MSEVGDLV--EVEPEMEQE---ADYGDYGDYEHE 130
            ||..:.....|:|.  |::...|.:||.   .|:|.|.:  ||..::.:|   ...|:...|..|
  Fly   158 LRAKLTTELRKELA--EEVRSEVRKELAEEVRSQVRDDLRNEVSEDIRKEQLAMLLGELEVYLTE 220

  Fly   131 PSYG--------HPRDNERVEEDLDMYPPSSPSLPPSPPRPPSPVVQ--PASKARNSAR--QIAL 183
            ...|        .|....:|:||..   ||.......|.|.||.|..  .|::||..|:  :..|
  Fly   221 KKAGRWESLDGSEPETKPQVKEDAS---PSRSKTKALPKRRPSLVDANLKATEARKDAKEEEFIL 282

  Fly   184 RSFVSQKNNDD---DDGSVKEVKPSEKMLEEFKGPRRYMLFDDLI------------ATIVDFDE 233
            .......||.|   |...:.|..|:|.. |:|:  ...|:..|::            |:..|.::
  Fly   283 GCNTDPANNSDVNIDGLELDEEVPAESG-EDFR--EINMVGSDVVHTDNGEIYIINSASSEDQNQ 344

  Fly   234 DSTP-----------------LVEFS-----MISDIM---------------------------- 248
            ||||                 .::||     .|.|::                            
  Fly   345 DSTPEFDQDNGITSYNIKEDGEIQFSGEKPEEIEDVVVFNLGEEISQEQQVFSFHENVIIVEKEQ 409

  Fly   249 ---DEKLPV-------------------------------ECGICPDVMHKSK-LSKHHKTHL-- 276
               ||:.|:                               :|.:||......| |::||.||:  
  Fly   410 NDRDEQTPLKRKRSSELVFKQESSCPQPKTGRITDTVKSFQCHLCPVAFPTQKLLTRHHNTHIKG 474

  Fly   277 ----VPGTNRYACIYCTETYRDCKYLAGHARRHMGIRPYVCELCTLYFSTKQDLRVHNQRRHLEK 337
                ..||.:  |..|.........|..|...|.|::|:.|..|.|.||.::.|:.|.......|
  Fly   475 LKSGKGGTLK--CPSCALQLSCASSLKRHMIIHTGLKPFKCSECELSFSQREVLKRHMDTHTGVK 537

  Fly   338 EHICEVCGKTFAQNTQLKRHREATH-EKKRRFQCEYCQKAYYKNFSLQEHIRNVHMGKRRMLKCP 401
            .|.|..|...|||.:.|::|....| ...|..:|..|.:::.....|..|: ..|.|.  |..|.
  Fly   538 RHQCPQCSSCFAQKSNLQQHIGRVHMGNSRTHKCHLCHRSFNHVSGLSRHL-VTHAGV--MFSCK 599

  Fly   402 FCGMQCRDAHKMARHRKEMH 421
            .||.|..|...:.||...||
  Fly   600 QCGRQFNDRSAVQRHVTTMH 619

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2116NP_572444.2 C2H2 Zn finger 256..275 CDD:275368 7/19 (37%)
C2H2 Zn finger 285..305 CDD:275368 4/19 (21%)
PHA00733 <308..357 CDD:177301 16/48 (33%)
C2H2 Zn finger 313..334 CDD:275368 7/20 (35%)
C2H2 Zn finger 341..362 CDD:275368 7/20 (35%)
C2H2 Zn finger 370..388 CDD:275368 4/17 (24%)
C2H2 Zn finger 400..418 CDD:275370 7/17 (41%)
C2H2 Zn finger 429..447 CDD:275368
CG31365NP_732827.1 zf-AD 13..86 CDD:214871
vATP-synt_E 109..>244 CDD:304907 32/142 (23%)
RRF <161..222 CDD:294170 15/62 (24%)
zf-C2H2_8 454..530 CDD:292531 23/77 (30%)
C2H2 Zn finger 485..505 CDD:275368 4/19 (21%)
zf-H2C2_2 497..522 CDD:290200 9/24 (38%)
C2H2 Zn finger 513..533 CDD:275368 7/19 (37%)
zf-H2C2_2 526..550 CDD:290200 7/23 (30%)
C2H2 Zn finger 541..562 CDD:275368 7/20 (35%)
C2H2 Zn finger 571..591 CDD:275368 4/20 (20%)
C2H2 Zn finger 598..617 CDD:275368 7/18 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446680
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.