DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2116 and su(Hw)

DIOPT Version :9

Sequence 1:NP_572444.2 Gene:CG2116 / 31735 FlyBaseID:FBgn0030003 Length:598 Species:Drosophila melanogaster
Sequence 2:NP_001247098.1 Gene:su(Hw) / 41740 FlyBaseID:FBgn0003567 Length:941 Species:Drosophila melanogaster


Alignment Length:698 Identity:137/698 - (19%)
Similarity:243/698 - (34%) Gaps:191/698 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 NEVIEFVLPANSDYSD---EDNRGNVRVINTSDDATYVLLDNLGNEFEEDIIIVNENGVEK---E 67
            ::.|:|:|..:.:...   |:|.|. .::.|.||      ::||.:.:||    .|:...|   .
  Fly   157 DDTIDFILADDEEVVPGRIENNNGQ-EIVVTEDD------EDLGEDGDED----GEDSSGKGNSS 210

  Fly    68 MLMSKELRDFIVGS------RVKDLTDDEQMPQ----FVVRELDMSEVGDLVEVEPEMEQEAD-- 120
            ....||:.:.:.|.      ||:.|....:..:    :.:|:.||.:..:.:|.:..:.::.|  
  Fly   211 QTKIKEIVEHVCGKCYKTFRRVQSLKKHLEFCRYDSGYHLRKADMLKNLEKIEKDAVVMEKKDIC 275

  Fly   121 -----------------------YGDYGDYEHEPSYGHP----------RDNERVEEDLDMYPPS 152
                                   :.....||......|.          ..|.|.|..|.::.. 
  Fly   276 FCCSESYDTFHLGHINCPDCPKSFKTQTSYERHIFITHSEFSDFPCSICNANLRSEALLALHEE- 339

  Fly   153 SPSLPPSPPRPPSPVVQPASKARNSARQIALRSFV------------SQKNNDDDDGSVKEVKPS 205
                            |..|:.:..|.:|..:.|.            |..:|:.|..|.|.....
  Fly   340 ----------------QHKSRGKPYACKICGKDFTRSYHLKRHQKYSSCSSNETDTMSCKVCDRV 388

  Fly   206 EKMLEEFKGPRRYMLFDDLIATIVDFDEDSTPLVEFSMISDIMDEKLPVECGICPDVMHK-SKLS 269
            ...|:..:...:..|...::                        :|....|..|.:..:. |.|:
  Fly   389 FYRLDNLRSHLKQHLGTQVV------------------------KKPEYMCHTCKNCFYSLSTLN 429

  Fly   270 KHHKTHLVPGTNRYACIYCTETYRDCKYLAGHARRHMGIRPYVCELCTLYFSTKQDLRVHNQRRH 334
            .|.:||  .|...:.|..|.:.:.....|..|.|.|.|.:||.|.:|...|:.|:.|..|.:|..
  Fly   430 IHIRTH--TGEKPFDCDLCDKKFSALVALKKHRRYHTGEKPYSCTVCNQAFAVKEVLNRHMKRHT 492

  Fly   335 LEKEHICEVCGKTFAQNTQLKRHREATHEKKRRFQCEYCQKAYYKNFSLQEHIRNVHMGKRRMLK 399
            .|:.|.|:.|||:|.|.|||:.|.: ||  .|.|.||.|.:.:.....|:.|::.....||.:..
  Fly   493 GERPHKCDECGKSFIQATQLRTHSK-TH--IRPFPCEQCDEKFKTEKQLERHVKTHSRTKRPVFS 554

  Fly   400 CPFCGMQCRDAHKMARHR-------KEMHLSQGTYV-------CHLCQEEFTDISYFDAHKRSI- 449
            |..|....|....:..|.       |:...|..:.|       |.:|.:.|........|.|:: 
  Fly   555 CAECKRNFRTPALLKEHMDEGKHSPKQQRSSMRSAVKIMERTDCAICDKNFDSSDTLRRHIRTVH 619

  Fly   450 QCRSNTRRFVNADGNREGS---DSESI--------SGRNMNGQDDDYDGMGPLQEEY--DEDDG- 500
            :|..:....|....::...   :||.:        :|..::.|.   ||.|.:..|:  ||.|| 
  Fly   620 ECDPDDIFGVEPHPSKRAKKDIESEEVVPVALNTSAGSLISSQT---DGNGVVVREFLVDEGDGA 681

  Fly   501 --LLVEDNQPEE----QGSPSNRQYLDES---------EQQYVQLSDYDDQHLLVENAVDAEDGG 550
              .:..:|:...    .|:....|..||:         |.|...:...:.:..|..:...|.  .
  Fly   682 AQTITLENETYTILPLDGAIEGEQLTDEAGVKPEAKKEEAQVSPVVKKEQRKSLAASLAAAI--A 744

  Fly   551 EDLDELLTEDQYFNAVQQHHQQHQQHHGRGQDYNDELIYEITLKTEDN 598
            ::|:|..:||                     |::.|::.|..:|.::|
  Fly   745 DNLEESCSED---------------------DFSGEILTEEDIKLKEN 771

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2116NP_572444.2 C2H2 Zn finger 256..275 CDD:275368 5/19 (26%)
C2H2 Zn finger 285..305 CDD:275368 5/19 (26%)
PHA00733 <308..357 CDD:177301 20/48 (42%)
C2H2 Zn finger 313..334 CDD:275368 7/20 (35%)
C2H2 Zn finger 341..362 CDD:275368 10/20 (50%)
C2H2 Zn finger 370..388 CDD:275368 5/17 (29%)
C2H2 Zn finger 400..418 CDD:275370 4/24 (17%)
C2H2 Zn finger 429..447 CDD:275368 4/17 (24%)
su(Hw)NP_001247098.1 C2H2 Zn finger 292..313 CDD:275368 2/20 (10%)
COG5048 <312..517 CDD:227381 54/247 (22%)
C2H2 Zn finger 321..341 CDD:275368 4/36 (11%)
zf-C2H2 348..368 CDD:278523 3/19 (16%)
C2H2 Zn finger 350..368 CDD:275368 2/17 (12%)
C2H2 Zn finger 382..402 CDD:275368 2/19 (11%)
C2H2 Zn finger 415..435 CDD:275368 5/19 (26%)
zf-H2C2_2 428..451 CDD:290200 7/24 (29%)
C2H2 Zn finger 443..463 CDD:275368 5/19 (26%)
zf-H2C2_2 455..479 CDD:290200 9/23 (39%)
COG5048 <467..620 CDD:227381 44/155 (28%)
C2H2 Zn finger 471..491 CDD:275368 6/19 (32%)
zf-H2C2_2 484..508 CDD:290200 10/23 (43%)
C2H2 Zn finger 499..519 CDD:275368 10/20 (50%)
C2H2 Zn finger 525..545 CDD:275368 5/19 (26%)
C2H2 Zn finger 555..572 CDD:275368 3/16 (19%)
C2H2 Zn finger 598..615 CDD:275371 3/16 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446716
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.