DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2116 and topi

DIOPT Version :9

Sequence 1:NP_572444.2 Gene:CG2116 / 31735 FlyBaseID:FBgn0030003 Length:598 Species:Drosophila melanogaster
Sequence 2:NP_649945.1 Gene:topi / 41199 FlyBaseID:FBgn0037751 Length:814 Species:Drosophila melanogaster


Alignment Length:359 Identity:90/359 - (25%)
Similarity:141/359 - (39%) Gaps:94/359 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   250 EKLPVECGICPDV----------------MHKSKLSKHHKTHLVPGTNRYACIYCTETYRDCKYL 298
            :||.:.|..| ||                ::|.|..|..:........:|.|..|.::|....:|
  Fly   463 KKLLLPCDFC-DVNFEFAHDFLAHSEEKHLNKKKREKETRNTGAGRIRQYLCDICGKSYTQSSHL 526

  Fly   299 AGHARRHMGIRPYVC--ELCTLYFSTKQDLRVHNQRRHL-EKEHICEVCGKTFAQNTQLKRHREA 360
            ..|.|.|.|::|:||  |.|...|:.:.||..|.::.|. |:.::|.||||.|...:...:|| .
  Fly   527 WQHLRFHQGVKPFVCQEENCDRKFTIRPDLNDHIRKCHTGERPYLCLVCGKRFLTGSVFYQHR-L 590

  Fly   361 THEKKRRFQCEYCQKAYYKNFSLQEHIRNVHMGKRRMLKCPFCGMQC-----RDAHKMARHRKEM 420
            .|..:||::||.|.|.:|:..:|:.|.| :|.|: :...|.||....     ||.|..|||    
  Fly   591 IHRGERRYECEECGKRFYRADALKNHQR-IHTGE-KPYSCLFCTKTFRQRGDRDKHIRARH---- 649

  Fly   421 HLSQGTYVCHLCQEEFTDISYFDAHKRSIQCRSNTRRFVNADGNREGSDSESISGRNMNGQDDDY 485
                               |:.||:.|.:.   ..::|     ..|.:.::.....|...||:|.
  Fly   650 -------------------SHLDANSRLMM---QMQKF-----QLETAAAQKAQSHNPEQQDNDV 687

  Fly   486 DGMGPLQEEYDEDDGLLVEDNQPEEQGSPSNRQYLDESEQQ-------------------YVQL- 530
            .| |....:.....|.:  ..:|    |.:..||....|||                   |:|. 
  Fly   688 AG-GASTSDVPSGSGFM--STEP----SVAEMQYSITPEQQEEMVCVPIDEVNNSFFMSHYMQAV 745

  Fly   531 ---SDYDDQHLLVENAVDAEDGGEDLDELLTEDQ 561
               .|...||::|     .|..|:::|.:...||
  Fly   746 PMEEDGSGQHIIV-----FEQPGQNMDMMSIYDQ 774

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2116NP_572444.2 C2H2 Zn finger 256..275 CDD:275368 7/34 (21%)
C2H2 Zn finger 285..305 CDD:275368 6/19 (32%)
PHA00733 <308..357 CDD:177301 17/51 (33%)
C2H2 Zn finger 313..334 CDD:275368 7/22 (32%)
C2H2 Zn finger 341..362 CDD:275368 8/20 (40%)
C2H2 Zn finger 370..388 CDD:275368 7/17 (41%)
C2H2 Zn finger 400..418 CDD:275370 9/22 (41%)
C2H2 Zn finger 429..447 CDD:275368 3/17 (18%)
topiNP_649945.1 C2H2 Zn finger 230..250 CDD:275368
C2H2 Zn finger 277..297 CDD:275368
C2H2 Zn finger 431..453 CDD:275368
COG5048 <450..647 CDD:227381 56/187 (30%)
C2H2 Zn finger 469..490 CDD:275368 4/21 (19%)
zf-C2H2 511..533 CDD:278523 7/21 (33%)
C2H2 Zn finger 513..564 CDD:275368 17/50 (34%)
C2H2 Zn finger 541..561 CDD:275368 7/19 (37%)
zf-H2C2_2 555..581 CDD:290200 11/25 (44%)
C2H2 Zn finger 572..592 CDD:275368 8/20 (40%)
zf-H2C2_2 585..609 CDD:290200 9/24 (38%)
zf-C2H2 598..620 CDD:278523 8/22 (36%)
C2H2 Zn finger 600..620 CDD:275368 8/20 (40%)
zf-H2C2_2 612..637 CDD:290200 8/26 (31%)
C2H2 Zn finger 628..646 CDD:275368 6/17 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446677
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.