DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2116 and CG8319

DIOPT Version :9

Sequence 1:NP_572444.2 Gene:CG2116 / 31735 FlyBaseID:FBgn0030003 Length:598 Species:Drosophila melanogaster
Sequence 2:NP_649920.2 Gene:CG8319 / 41165 FlyBaseID:FBgn0037722 Length:383 Species:Drosophila melanogaster


Alignment Length:407 Identity:88/407 - (21%)
Similarity:152/407 - (37%) Gaps:115/407 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 GVEKEML--MSKELRDFIVGSRVKD---------LTDDEQMPQ---------------------- 94
            |..:.||  ...::.:::.|:::.:         |..|:.|||                      
  Fly    10 GASENMLGIFDDQVEEYVDGAKLAEMVKTCADVQLDPDDAMPQKMCISCVHDARTAYGFKRRCEE 74

  Fly    95 ----FVVRELDMSEVGDLVEVEPEMEQEADYGDYGDYEHEPSYGHPRDNERVEEDLDMYPPSSPS 155
                |.:..|:    |.:::.||..|      |:...|: |..|:....:::.:::         
  Fly    75 NYKKFYLAILN----GQVIKDEPNEE------DFLFIEN-PDKGNLEAKKKLNKEI--------- 119

  Fly   156 LPPSPPRPPSPVVQPASKARNSA-------RQIALRSFVSQKNNDDDDGSVKEVKPSEKMLEEFK 213
                     ....|.||:...|:       ||  |||..:|  ....:..:|:.|....:|:..|
  Fly   120 ---------KKTHQTASRTTKSSITTSRAGRQ--LRSIKNQ--TFKCELCIKQFKRQINLLDHMK 171

  Fly   214 ----------GPRRYMLFDDL--------IATIVDFDE-----DSTPLVEFSMISDIMDEKLPVE 255
                      ...|::...||        ..:.|:..|     .||..::.....| |.|:.|.:
  Fly   172 VHSNSHVCQNCEERFLFKADLDNHQCYRNSNSTVECPECLKVFSSTQSLDSHKCKD-MQERSPFQ 235

  Fly   256 CGICPDVMHKSKLSKHHKTHLV------PGTNRYACIYCTETYRDCKYLAGHARRHMGIRPYVCE 314
            |..|.....:   .::.|.||:      .|...:.|.||...:.:...|..|...|||.||:.|.
  Fly   236 CPHCQQAFTR---EQNLKAHLLIHAESKQGNGPHKCSYCQTGFFNKSALKVHIHAHMGERPHACP 297

  Fly   315 LCTLYFSTKQDLRVHNQRRHLEKEHICEVCGKTFAQNTQLKRHREATHEKKRRFQCEYCQKAYYK 379
            .|...|.:||.|:||.:....||.:.|..|.|||:.|..|.:||. .|..:|.::|..|    .:
  Fly   298 FCVSNFRSKQALKVHIRIHTGEKPYQCPHCPKTFSDNNNLAKHRR-RHSDERPYKCSIC----LQ 357

  Fly   380 NFSLQEHIRNVHMGKRR 396
            :|..:.|::...:||.|
  Fly   358 DFREKHHLKRHFLGKHR 374

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2116NP_572444.2 C2H2 Zn finger 256..275 CDD:275368 3/18 (17%)
C2H2 Zn finger 285..305 CDD:275368 5/19 (26%)
PHA00733 <308..357 CDD:177301 19/48 (40%)
C2H2 Zn finger 313..334 CDD:275368 8/20 (40%)
C2H2 Zn finger 341..362 CDD:275368 9/20 (45%)
C2H2 Zn finger 370..388 CDD:275368 4/17 (24%)
C2H2 Zn finger 400..418 CDD:275370
C2H2 Zn finger 429..447 CDD:275368
CG8319NP_649920.2 zf-AD 4..79 CDD:285071 9/68 (13%)
COG5048 <153..368 CDD:227381 56/223 (25%)
C2H2 Zn finger 153..173 CDD:275368 4/19 (21%)
C2H2 Zn finger 179..196 CDD:275368 3/16 (19%)
C2H2 Zn finger 207..227 CDD:275370 3/19 (16%)
C2H2 Zn finger 236..256 CDD:275368 5/22 (23%)
C2H2 Zn finger 268..288 CDD:275368 5/19 (26%)
C2H2 Zn finger 296..316 CDD:275368 8/19 (42%)
zf-H2C2_2 308..332 CDD:290200 9/23 (39%)
zf-C2H2 322..344 CDD:278523 9/22 (41%)
C2H2 Zn finger 324..344 CDD:275368 9/20 (45%)
C2H2 Zn finger 352..368 CDD:275368 4/19 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449795
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.