DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2116 and ZNF793

DIOPT Version :9

Sequence 1:NP_572444.2 Gene:CG2116 / 31735 FlyBaseID:FBgn0030003 Length:598 Species:Drosophila melanogaster
Sequence 2:NP_001013681.2 Gene:ZNF793 / 390927 HGNCID:33115 Length:406 Species:Homo sapiens


Alignment Length:176 Identity:54/176 - (30%)
Similarity:86/176 - (48%) Gaps:14/176 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   255 ECG--ICPDVMHKSKLSKHHKTHLVPGTNRYACIYCTETYRDCKYLAGHARRHMGIRPYVCELCT 317
            |||  .|    :||:..:|.::|  .|...|.|..|.:.:.....|..|.|.|.|:||:.|..|.
Human   231 ECGKAFC----YKSEFIRHQRSH--TGEKPYGCTDCGKAFSHKSTLIKHQRIHTGVRPFECFFCG 289

  Fly   318 LYFSTKQDLRVHNQRRHL-EKEHICEVCGKTFAQNTQLKRHREATHEKKRRFQCEYCQKAYYKNF 381
            ..| |::..|..:||.|. |:..:|..|||:|.:.:.|..||: .|..:|.::|..|.|::.:..
Human   290 KAF-TQKSHRTEHQRTHTGERPFVCSECGKSFGEKSYLNVHRK-MHTGERPYRCRECGKSFSQKS 352

  Fly   382 SLQEHIRNVHMGKRRMLKCPFCGMQCRDAHKMARHRKEMHLSQGTY 427
            .|.:|.| .|.|: :...|..||........::||:| :|..:..|
Human   353 CLNKHWR-THTGE-KPYGCNECGKAFYQKPNLSRHQK-IHARKNAY 395

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2116NP_572444.2 C2H2 Zn finger 256..275 CDD:275368 6/20 (30%)
C2H2 Zn finger 285..305 CDD:275368 5/19 (26%)
PHA00733 <308..357 CDD:177301 17/49 (35%)
C2H2 Zn finger 313..334 CDD:275368 7/20 (35%)
C2H2 Zn finger 341..362 CDD:275368 8/20 (40%)
C2H2 Zn finger 370..388 CDD:275368 5/17 (29%)
C2H2 Zn finger 400..418 CDD:275370 5/17 (29%)
C2H2 Zn finger 429..447 CDD:275368
ZNF793NP_001013681.2 KRAB 8..68 CDD:214630
C2H2 Zn finger 190..221 CDD:275368
COG5048 <225..385 CDD:227381 49/163 (30%)
C2H2 Zn finger 229..249 CDD:275368 7/21 (33%)
C2H2 Zn finger 257..277 CDD:275368 5/19 (26%)
C2H2 Zn finger 285..305 CDD:275368 7/20 (35%)
C2H2 Zn finger 313..333 CDD:275368 8/20 (40%)
C2H2 Zn finger 341..361 CDD:275368 6/20 (30%)
C2H2 Zn finger 369..389 CDD:275368 6/20 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 104 1.000 Inparanoid score I4954
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.