DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2116 and CG17385

DIOPT Version :9

Sequence 1:NP_572444.2 Gene:CG2116 / 31735 FlyBaseID:FBgn0030003 Length:598 Species:Drosophila melanogaster
Sequence 2:NP_001286418.1 Gene:CG17385 / 36603 FlyBaseID:FBgn0033934 Length:278 Species:Drosophila melanogaster


Alignment Length:342 Identity:69/342 - (20%)
Similarity:133/342 - (38%) Gaps:101/342 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   229 VDFDEDSTPLVEFSMISDIMDEKLPVECGIC--------PDVMHKSKLSKHHKTHLVPGTNRYAC 285
            |:|||  |...:||             |..|        ...:|:.::..|:||       .|.|
  Fly     6 VEFDE--TVANQFS-------------CKRCDRTFRSKRDQTLHRQEVHNHNKT-------TYEC 48

  Fly   286 IYCTETYRDCKYLAGHARRHMGIRPYVCELCTLYFSTKQDLRVHNQRRHLEKEHICEVCGKTFAQ 350
            ..|.:::.:...|..|.:.|..:||:||.:|:..|:...:|:.|......|:...|..|.|:|.|
  Fly    49 KLCAKSFCNSGNLDRHMKVHNDVRPFVCNICSKAFAQAVNLQRHYAVHSGERPFTCNFCNKSFTQ 113

  Fly   351 NTQLKRHREATHEKKRRFQCEYCQKAYYKNFSLQEHIRNVHMGKRRMLKCPFCGMQCRDAHKMAR 415
            .:.:|||: .||..::.|:|:.|.:.:.:..:|::|                             
  Fly   114 QSNMKRHK-MTHTGEKPFRCQRCGRYFSQLVNLKKH----------------------------- 148

  Fly   416 HRKEMHLSQGTYVCHLCQEEFTDISYFDAHKRSIQCRSNTRRFVNADGNREGSDSESISGRNMNG 480
              |..||:...|.|:.|::.||.:|.|   ||.:|  |:.:..|:.|.......:.:::...:..
  Fly   149 --KLGHLNAKPYQCNYCEKGFTQLSNF---KRHLQ--SHIKEGVDVDVPASIQAAAALARERLES 206

  Fly   481 QDDD-----------YDGMGPLQEEYDEDDGLLVEDNQPEEQGSPSNRQYLDESEQQYVQLSDY- 533
            :...           :|...    :|::.:....||::         |..|:.::..::...|| 
  Fly   207 EQKPSFFECMVCRAIFDTFA----DYEKHEAKCHEDHE---------RAQLEVNQMSHMHPDDYL 258

  Fly   534 ---------DDQHLLVE 541
                     |...:::|
  Fly   259 PMKFAVPDLDTHEIIIE 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2116NP_572444.2 C2H2 Zn finger 256..275 CDD:275368 5/26 (19%)
C2H2 Zn finger 285..305 CDD:275368 4/19 (21%)
PHA00733 <308..357 CDD:177301 15/48 (31%)
C2H2 Zn finger 313..334 CDD:275368 5/20 (25%)
C2H2 Zn finger 341..362 CDD:275368 8/20 (40%)
C2H2 Zn finger 370..388 CDD:275368 4/17 (24%)
C2H2 Zn finger 400..418 CDD:275370 0/17 (0%)
C2H2 Zn finger 429..447 CDD:275368 6/17 (35%)
CG17385NP_001286418.1 COG5048 <13..181 CDD:227381 52/224 (23%)
C2H2 Zn finger 18..39 CDD:275368 3/20 (15%)
C2H2 Zn finger 48..68 CDD:275368 4/19 (21%)
C2H2 Zn finger 76..96 CDD:275368 5/19 (26%)
C2H2 Zn finger 104..124 CDD:275368 8/20 (40%)
C2H2 Zn finger 132..148 CDD:275368 3/15 (20%)
C2H2 Zn finger 160..180 CDD:275368 9/24 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449767
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.