DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2116 and rgr

DIOPT Version :9

Sequence 1:NP_572444.2 Gene:CG2116 / 31735 FlyBaseID:FBgn0030003 Length:598 Species:Drosophila melanogaster
Sequence 2:NP_001163089.2 Gene:rgr / 35843 FlyBaseID:FBgn0267792 Length:889 Species:Drosophila melanogaster


Alignment Length:495 Identity:111/495 - (22%)
Similarity:182/495 - (36%) Gaps:123/495 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 KRCLANEVIEFVL-----------PANSDYSDEDNRGNVRVINT--SDDATYVL--------LDN 47
            |..|.:||:.|:|           |.:.||:........|.|:.  .::..|.|        :..
  Fly   455 KSSLYHEVLSFILDAFKRQECLWNPQHYDYTTCCKTELFRDISVQLQEELNYELSGEECCNEIQK 519

  Fly    48 LGNEFEEDI-IIVNENGV---------EKEML-----------MSKELRDFIVGSRVKDLTDDEQ 91
            |...:.::: :::...|:         |.|.|           :||::.  :|||..|....|..
  Fly   520 LRTRYRKELRMVIKHKGLYLPKLWCYDEMEFLQPILQEQIFNKISKKIG--VVGSNQKTKFIDAS 582

  Fly    92 MPQFVVRELDMSEVGDLVEVEPEMEQEADYGDYG---DYEHEPSYGHPRDNERVEEDLDMYPPSS 153
            ..:|...|..:    ..||:         |.:|.   |.:| |.:                    
  Fly   583 SIRFDNTEKQL----QFVEI---------YHNYSALWDVDH-PDF-------------------- 613

  Fly   154 PSLPPSPPRPPSPVVQPASKARNSARQIALRSFVSQKNNDDDDGSVKEVKPSEKML----EEFKG 214
                                ..|:.|..||...:.:.|.........|  ..||.|    :||..
  Fly   614 --------------------RSNTYRSQALGQMLDEINTTFHTSYTAE--QLEKTLFNLRKEFSA 656

  Fly   215 PRRYMLFDDLIATIVDFDEDSTPLVEFSMISDIMDEKL-PVECGICPDVMHKSKLSK-HHKTHLV 277
            .:|.:|.:       ..|..|.||:. :.:::.:|:.| |..|.||.|::......| |...|  
  Fly   657 QKRKILTE-------SEDSSSIPLLH-AKLAEFLDQNLGPFRCDICSDLVKTCDQYKVHRSAH-- 711

  Fly   278 PGTNRYACIYCTETYRDCKYLAGHARRHMGIRPYVCELCTLYFSTKQDLRVHNQRRHLEKEHICE 342
            .||..:.|..|.:.::....|..|.|||....||.||.|...|:|..::.:|.:....|:.:||:
  Fly   712 DGTQPFICTLCGKGFQMPCNLTVHIRRHRRDFPYSCEQCDKRFATSTEVAIHLRTHTGERPYICD 776

  Fly   343 VCGKTFAQNTQLKRHREATHEKKRRFQCEYCQKAYYKNFSLQEHIRNVHMGKRRMLKCPFCGMQC 407
            :|||:|...:....||. .|..:..|.|..|.|.:|:.....:|: |.|...|:.| |..||...
  Fly   777 LCGKSFKTWSFFDIHRR-RHLNQSTFHCPICAKGFYEKNRFTDHM-NSHWAIRKHL-CTVCGKTF 838

  Fly   408 RDAHKMARHRKEMHLSQGTYVCHLCQEEFTDISYFDAHKR 447
            .....:.:| .|:||:...|.|..|.:.|...:....||:
  Fly   839 TTYGNLKKH-TELHLAVKKYKCGTCGKRFAQFASLRWHKK 877

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2116NP_572444.2 C2H2 Zn finger 256..275 CDD:275368 6/19 (32%)
C2H2 Zn finger 285..305 CDD:275368 5/19 (26%)
PHA00733 <308..357 CDD:177301 15/48 (31%)
C2H2 Zn finger 313..334 CDD:275368 6/20 (30%)
C2H2 Zn finger 341..362 CDD:275368 7/20 (35%)
C2H2 Zn finger 370..388 CDD:275368 5/17 (29%)
C2H2 Zn finger 400..418 CDD:275370 4/17 (24%)
C2H2 Zn finger 429..447 CDD:275368 4/17 (24%)
rgrNP_001163089.2 MADF_DNA_bdg 335..420 CDD:287510
MADF_DNA_bdg 465..551 CDD:287510 13/85 (15%)
MADF_DNA_bdg 595..682 CDD:287510 24/146 (16%)
C2H2 Zn finger 691..711 CDD:275368 6/19 (32%)
C2H2 Zn finger 719..739 CDD:275368 5/19 (26%)
zf-H2C2_2 731..756 CDD:290200 11/24 (46%)
COG5048 742..>824 CDD:227381 25/83 (30%)
C2H2 Zn finger 747..767 CDD:275368 6/19 (32%)
zf-H2C2_2 763..784 CDD:290200 8/20 (40%)
C2H2 Zn finger 775..795 CDD:275368 7/20 (35%)
C2H2 Zn finger 803..818 CDD:275368 4/14 (29%)
C2H2 Zn finger 831..851 CDD:275368 5/20 (25%)
C2H2 Zn finger 859..877 CDD:275368 4/17 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.