DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2116 and CG17328

DIOPT Version :9

Sequence 1:NP_572444.2 Gene:CG2116 / 31735 FlyBaseID:FBgn0030003 Length:598 Species:Drosophila melanogaster
Sequence 2:NP_609786.2 Gene:CG17328 / 34962 FlyBaseID:FBgn0028895 Length:413 Species:Drosophila melanogaster


Alignment Length:298 Identity:70/298 - (23%)
Similarity:106/298 - (35%) Gaps:66/298 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   200 KEVKPSEKMLEEFKGPRRYMLFDDLIATIVDFDEDSTPLVEFSMISDIMDEKLPVECGIC----- 259
            :|.:.|:..|.::.|.......|  .||..||.|  .||:.    ....||:.||:..:.     
  Fly    69 QECENSDLRLRQYLGILESWRQD--AATNTDFVE--KPLLP----QRDSDEEEPVDAKVSKRRSR 125

  Fly   260 ----PDVMHKSKLSKHHKTHLVPGTNRYACIYCTETYRDCKYLAGHARRHMGIRPYVCELCTLYF 320
                |...||.:..|.     || ...:.|..|.::::....|..|.|.|.|.:||.|..|...|
  Fly   126 YQRKPPEEHKKRGPKP-----VP-KMPHTCYECHKSFKCIAQLTQHIRTHTGEKPYQCSFCIQRF 184

  Fly   321 STKQDLRVHNQRRHLEKEHICEVCGKTFAQNTQLKRHREATHEKKRRFQCEYCQKAYYKNFSLQE 385
            :.|.:|:||.:....:|...||:|.|.|:.....:.|:: .|...|...|..|||.:|....|.:
  Fly   185 AQKYNLKVHERTHTGDKPFQCEICSKQFSALGNFQAHQK-IHLGVRDQVCSLCQKGFYTAGDLSK 248

  Fly   386 H------IRNVHMGKRRMLKCPFCGMQCRDAHKMARHRKEMH----------------------- 421
            |      |:|.|        |..||........|..|:.::|                       
  Fly   249 HMITHTGIKNHH--------CDVCGKAFSRRRDMRTHKLKLHPLESSTNHDIVDDDDDEAIDTDP 305

  Fly   422 -----LSQGTYVCHLCQEEFTDISYFDAHKRSIQCRSN 454
                 |....:.|..|.:.|........|.|:....:|
  Fly   306 VGLDTLDHAHFKCPDCDKAFDTADSLSLHFRTHAANNN 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2116NP_572444.2 C2H2 Zn finger 256..275 CDD:275368 4/27 (15%)
C2H2 Zn finger 285..305 CDD:275368 5/19 (26%)
PHA00733 <308..357 CDD:177301 15/48 (31%)
C2H2 Zn finger 313..334 CDD:275368 7/20 (35%)
C2H2 Zn finger 341..362 CDD:275368 6/20 (30%)
C2H2 Zn finger 370..388 CDD:275368 7/23 (30%)
C2H2 Zn finger 400..418 CDD:275370 5/17 (29%)
C2H2 Zn finger 429..447 CDD:275368 4/17 (24%)
CG17328NP_609786.2 zf-AD 8..80 CDD:214871 3/10 (30%)
COG5048 146..>211 CDD:227381 20/64 (31%)
C2H2 Zn finger 149..169 CDD:275368 5/19 (26%)
C2H2 Zn finger 177..197 CDD:275368 7/19 (37%)
zf-H2C2_2 189..213 CDD:404364 8/23 (35%)
C2H2 Zn finger 205..225 CDD:275368 6/20 (30%)
C2H2 Zn finger 233..253 CDD:275368 7/19 (37%)
zf-H2C2_2 245..270 CDD:404364 8/32 (25%)
C2H2 Zn finger 261..282 CDD:275368 5/20 (25%)
C2H2 Zn finger 318..338 CDD:275368 5/19 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449805
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.