DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2116 and ZNF713

DIOPT Version :9

Sequence 1:NP_572444.2 Gene:CG2116 / 31735 FlyBaseID:FBgn0030003 Length:598 Species:Drosophila melanogaster
Sequence 2:NP_872439.2 Gene:ZNF713 / 349075 HGNCID:22043 Length:443 Species:Homo sapiens


Alignment Length:434 Identity:99/434 - (22%)
Similarity:166/434 - (38%) Gaps:109/434 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 VLLDNLGN-----------------EFEEDIIIVNENGVEKEMLMSK----ELRDFIVGSRV-KD 85
            |:|:|..|                 |.||:.:|      |::.|:..    |.|..|..|.. ::
Human    60 VMLENYRNLVALGYQLCKPEVIAQLELEEEWVI------ERDSLLDTHPDGENRPEIKKSTTSQN 118

  Fly    86 LTDDEQMPQFVVRELD-----MSEVGDL--VEVEPEMEQEADYGDYGDYEHEPSYGHPRDNERVE 143
            ::|:.|..:.::..|.     .|.:|.|  .:..||..||    ::..|..:.:..|.:      
Human   119 ISDENQTHEMIMERLAGDSFWYSILGGLWDFDYHPEFNQE----NHKRYLGQVTLTHKK------ 173

  Fly   144 EDLDMYPPSSPSLPPSPPRPPSPVVQPASKARNS-ARQIALRSFVSQKN--------NDDDDGSV 199
                                   :.|..|...|. |....|.|.:.|:.        |.|..|: 
Human   174 -----------------------ITQERSLECNKFAENCNLNSNLMQQRIPSIKIPLNSDTQGN- 214

  Fly   200 KEVKPSEKMLEEFKGPRRYMLFDDLIATIVDFDEDSTPLVEFSMISD-IMDEKLPVECGICPDVM 263
             .:|.:..::        |...:.:..|..::.|......:..:::| |...:.|.|||  ....
Human   215 -SIKHNSDLI--------YYQGNYVRETPYEYSECGKIFNQHILLTDHIHTAEKPSECG--KAFS 268

  Fly   264 HKSKLSKHHKTHLVPGTNRYACIYCTETYRDCKYLAGHARRHMGIRPYVCELCTLYF----STKQ 324
            |.|.||:...  |:.|...|.|..|.:.:....:|..|.|.|.|.:|::|..|...|    |..|
Human   269 HTSSLSQPQM--LLTGEKPYKCDECGKRFSQRIHLIQHQRIHTGEKPFICNGCGKAFRQHSSFTQ 331

  Fly   325 DLRVHNQRRHLEKEHICEVCGKTFAQNTQLKRHREATHEKKRRFQCEYCQKAYYKNFSLQEHIRN 389
            .||:|..    ||.:.|..|||.|::.|.|..|.. .|..::.::|.:|.||:.:...|.:|.| 
Human   332 HLRIHTG----EKPYKCNQCGKAFSRITSLTEHHR-LHTGEKPYECGFCGKAFSQRTHLNQHER- 390

  Fly   390 VHMGKRRMLKCPFCGMQCRDAHKMARHRKEMHLSQGTYVCHLCQ 433
            .|.|: :..||..||.....:..:.:||| :|..:     .||:
Human   391 THTGE-KPYKCNECGKAFSQSAHLNQHRK-IHTRE-----KLCE 427

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2116NP_572444.2 C2H2 Zn finger 256..275 CDD:275368 6/18 (33%)
C2H2 Zn finger 285..305 CDD:275368 5/19 (26%)
PHA00733 <308..357 CDD:177301 18/52 (35%)
C2H2 Zn finger 313..334 CDD:275368 8/24 (33%)
C2H2 Zn finger 341..362 CDD:275368 8/20 (40%)
C2H2 Zn finger 370..388 CDD:275368 6/17 (35%)
C2H2 Zn finger 400..418 CDD:275370 4/17 (24%)
C2H2 Zn finger 429..447 CDD:275368 2/5 (40%)
ZNF713NP_872439.2 KRAB 32..91 CDD:214630 7/30 (23%)
KRAB 32..71 CDD:279668 4/10 (40%)
C2H2 Zn finger 261..280 CDD:275368 7/22 (32%)
COG5048 284..>349 CDD:227381 21/68 (31%)
zf-C2H2 286..308 CDD:278523 6/21 (29%)
C2H2 Zn finger 288..308 CDD:275368 5/19 (26%)
zf-H2C2_2 300..325 CDD:290200 9/24 (38%)
C2H2 Zn finger 316..336 CDD:275368 7/19 (37%)
zf-H2C2_2 328..353 CDD:290200 12/28 (43%)
C2H2 Zn finger 344..364 CDD:275368 8/20 (40%)
zf-H2C2_2 356..381 CDD:290200 7/25 (28%)
C2H2 Zn finger 372..392 CDD:275368 7/20 (35%)
zf-H2C2_2 384..409 CDD:290200 9/26 (35%)
C2H2 Zn finger 400..420 CDD:275368 6/20 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 104 1.000 Inparanoid score I4954
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.