DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2116 and Plzf

DIOPT Version :9

Sequence 1:NP_572444.2 Gene:CG2116 / 31735 FlyBaseID:FBgn0030003 Length:598 Species:Drosophila melanogaster
Sequence 2:NP_001285862.1 Gene:Plzf / 34622 FlyBaseID:FBgn0032401 Length:469 Species:Drosophila melanogaster


Alignment Length:429 Identity:89/429 - (20%)
Similarity:135/429 - (31%) Gaps:146/429 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   107 DLVEVEPEMEQEADYGDYGDYEHEPSYGHPRDNERVEEDLDMYPPSSPSLPPSPPRPPSPVVQPA 171
            |||.|..              |||..:........|.|.|::|.                 :||.
  Fly   101 DLVSVSK--------------EHELHFRELAQILAVTELLNLYQ-----------------LQPL 134

  Fly   172 SKARNSARQIALRSFVSQKNNDDDDGSVKEVKPSEKMLEEFKGPRRYMLFDDLIATIVDFDEDST 236
            .:|: .|.:|....  ..:.|.|.:...:.|..:.:...:.|.||..               .|:
  Fly   135 GEAK-EATEIPAPG--EAQPNPDPEKKAEAVFENRQSYFKLKNPRAV---------------KSS 181

  Fly   237 PLVEFSMISDI---MDEKLPVECGICPDVMHKSKLSKHHKTHLVPGTNRYACIYCTETYRDCKYL 298
            ..|.:.:..|.   ..:|:....|.|            ..:||:       |..|...:.|.:..
  Fly   182 SKVNYCIGCDFKCYQVQKMIEHMGSC------------EPSHLI-------CSLCEVGFLDWREY 227

  Fly   299 AGHARRHMG--IRPYVCELCTLYFSTKQDLRVHNQRRHLEKEHICEVCGKTFA------------ 349
            ..|.|||.|  .:|:.|..|.:.|:|:..|.||..:...|..|||..|||.|.            
  Fly   228 DTHLRRHSGDLRKPFFCLQCGIRFNTRAALLVHQPKHSTETPHICPHCGKGFKWKQGLSNHILVH 292

  Fly   350 ---------------------------------------------QNTQLKRHREATHEKKRRFQ 369
                                                         :...||.|.| ||::.|.|.
  Fly   293 NPEKQMLCDVCGYSTTHMKALKSHKLLHTGEFFACTVSGCKHRANRKENLKLHIE-THKQGRDFI 356

  Fly   370 CEYCQKAYYKNFSLQEH-IRNVHMGKRRMLKCPFCGMQCRDAHKMARHRKEMHLSQGTYVCHLCQ 433
            ||.|...:.::.:|:.| :::...|..| .||..||.....:.||..|.:.:|..:..   .|..
  Fly   357 CEVCGCKFSQSKNLKRHALKHTENGPNR-YKCQLCGFSSHRSDKMKEHVQRVHTEKPV---QLEL 417

  Fly   434 EEFTDISYFD----------AHKRSIQCRSNTRRFVNAD 462
            .|..|.|:.|          ..|:....:|.|.|.||.|
  Fly   418 SETVDSSFPDDFELPVIETSPKKKPKSVKSKTIRNVNPD 456

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2116NP_572444.2 C2H2 Zn finger 256..275 CDD:275368 2/18 (11%)
C2H2 Zn finger 285..305 CDD:275368 5/19 (26%)
PHA00733 <308..357 CDD:177301 18/105 (17%)
C2H2 Zn finger 313..334 CDD:275368 7/20 (35%)
C2H2 Zn finger 341..362 CDD:275368 9/77 (12%)
C2H2 Zn finger 370..388 CDD:275368 5/18 (28%)
C2H2 Zn finger 400..418 CDD:275370 6/17 (35%)
C2H2 Zn finger 429..447 CDD:275368 5/27 (19%)
PlzfNP_001285862.1 COG5048 <193..403 CDD:227381 50/230 (22%)
C2H2 Zn finger 214..234 CDD:275368 5/19 (26%)
C2H2 Zn finger 244..264 CDD:275368 7/19 (37%)
C2H2 Zn finger 272..292 CDD:275368 5/19 (26%)
C2H2 Zn finger 300..320 CDD:275368 0/19 (0%)
C2H2 Zn finger 330..349 CDD:275368 4/19 (21%)
C2H2 Zn finger 357..377 CDD:275368 5/19 (26%)
C2H2 Zn finger 387..408 CDD:275368 6/20 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446678
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.