DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2116 and ZNF763

DIOPT Version :9

Sequence 1:NP_572444.2 Gene:CG2116 / 31735 FlyBaseID:FBgn0030003 Length:598 Species:Drosophila melanogaster
Sequence 2:NP_001012771.1 Gene:ZNF763 / 284390 HGNCID:27614 Length:397 Species:Homo sapiens


Alignment Length:382 Identity:88/382 - (23%)
Similarity:139/382 - (36%) Gaps:112/382 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   175 RNSARQIALRSF-----VSQKNNDDDDGSVKEVKPSEKMLEEFKGPRRYMLFDDLI-ATIVDFDE 233
            |...|::.|.:|     :.:|..|            :.:..|::.|||.  |..|| ..:.:..|
Human    29 RKLYREVMLETFRNLTSIGKKWKD------------QNIEYEYQNPRRN--FRSLIEGNVNEIKE 79

  Fly   234 DSTPLVEFSMISD----IMDEKLPVE--------CG------------ICPDVMHKS-------- 266
            ||.....|:.:.|    ..::|...|        ||            |..|:.||:        
Human    80 DSHCGETFTQVPDDRLNFQEKKASPEAKSCDNFVCGEVGIGNSSFNMNIRGDIGHKAYEYQDYAP 144

  Fly   267 ---------KLSKHH-------KTHLVPGTNRYACIYCTETY------------------RDCKY 297
                     |..::|       :.|  .|...|||..|.:|:                  ..||:
Human   145 KPYKCQQPKKAFRYHPSFRTQERNH--TGEKPYACKECGKTFISHSGIRRRMVMHSGDGPYKCKF 207

  Fly   298 LAG----------HARRHMGIRPYVCELCTLYFSTKQDLRVHNQRRHLEKEHICEVCGKTFAQNT 352
            ...          |.|.|.|.:||.|:.|...||.....|:|.:....||.:.|:.|||.|..::
Human   208 CGKAVHCLRLYLIHERTHTGEKPYECKQCVKSFSYSATHRIHERTHTGEKPYECQQCGKAFHSSS 272

  Fly   353 QLKRHREATHEKKRRFQCEYCQKAYYKNFSLQEHIRNVHMGKRRMLKCPFCGMQCRDAHKMARHR 417
            ..:.|:. ||...:.::|:.|.|::....|.|.|.| .|.|: :..:|..|....|......|| 
Human   273 SFQAHKR-THTGGKPYECKQCGKSFSWCHSFQIHER-THTGE-KPCECSKCNKAFRSYRSYLRH- 333

  Fly   418 KEMHLSQGTYVCHLCQEEFTDISYFDAHKRS---------IQC-RSNTRRFVNADGN 464
            |..|..:..|.|..|::.||..|....|:|:         .|| ::.:.:|.|...|
Human   334 KRSHTGEKPYQCKECRKAFTYPSSLRRHERTHSAKKPYECKQCGKALSYKFSNTPKN 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2116NP_572444.2 C2H2 Zn finger 256..275 CDD:275368 8/54 (15%)
C2H2 Zn finger 285..305 CDD:275368 7/47 (15%)
PHA00733 <308..357 CDD:177301 15/48 (31%)
C2H2 Zn finger 313..334 CDD:275368 6/20 (30%)
C2H2 Zn finger 341..362 CDD:275368 6/20 (30%)
C2H2 Zn finger 370..388 CDD:275368 6/17 (35%)
C2H2 Zn finger 400..418 CDD:275370 5/17 (29%)
C2H2 Zn finger 429..447 CDD:275368 6/17 (35%)
ZNF763NP_001012771.1 KRAB 7..>49 CDD:214630 4/19 (21%)
KRAB 7..46 CDD:279668 4/16 (25%)
C2H2 Zn finger 149..169 CDD:275368 2/19 (11%)
COG5048 202..>390 CDD:227381 52/191 (27%)
C2H2 Zn finger 205..225 CDD:275368 4/19 (21%)
zf-H2C2_2 221..242 CDD:290200 9/20 (45%)
C2H2 Zn finger 233..253 CDD:275368 6/19 (32%)
zf-H2C2_2 247..270 CDD:290200 9/22 (41%)
C2H2 Zn finger 261..281 CDD:275368 6/20 (30%)
zf-H2C2_2 273..297 CDD:290200 6/24 (25%)
C2H2 Zn finger 289..309 CDD:275368 7/20 (35%)
zf-H2C2_2 301..326 CDD:290200 8/26 (31%)
C2H2 Zn finger 317..337 CDD:275368 6/20 (30%)
zf-H2C2_2 332..354 CDD:290200 8/22 (36%)
DUF45 <342..383 CDD:302795 10/40 (25%)
C2H2 Zn finger 345..365 CDD:275368 7/19 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 104 1.000 Inparanoid score I4954
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.