Sequence 1: | NP_572444.2 | Gene: | CG2116 / 31735 | FlyBaseID: | FBgn0030003 | Length: | 598 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001010879.2 | Gene: | ZIK1 / 284307 | HGNCID: | 33104 | Length: | 487 | Species: | Homo sapiens |
Alignment Length: | 220 | Identity: | 68/220 - (30%) |
---|---|---|---|
Similarity: | 99/220 - (45%) | Gaps: | 23/220 - (10%) |
- Green bases have known domain annotations that are detailed below.
Fly 253 PVECGICPDVMHK-SKLSKHHKTHLVPGTNRYACIYCTETYRDCKYLAGHARRHMGIRPYVCELC 316
Fly 317 TLYFSTKQDLRVHNQRRHL-EKEHICEVCGKTFAQNTQLKRHREATHEKKRRFQCEYCQKAYYKN 380
Fly 381 FSLQEHIRNVHMGKRRMLKCPFCGMQCRDAHKMARHRKEMHLSQGTYVCHLCQEEFTDISYFDAH 445
Fly 446 ------KRSIQCRSNTRRFVNADGN 464 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG2116 | NP_572444.2 | C2H2 Zn finger | 256..275 | CDD:275368 | 5/19 (26%) |
C2H2 Zn finger | 285..305 | CDD:275368 | 5/19 (26%) | ||
PHA00733 | <308..357 | CDD:177301 | 20/49 (41%) | ||
C2H2 Zn finger | 313..334 | CDD:275368 | 9/20 (45%) | ||
C2H2 Zn finger | 341..362 | CDD:275368 | 8/20 (40%) | ||
C2H2 Zn finger | 370..388 | CDD:275368 | 5/17 (29%) | ||
C2H2 Zn finger | 400..418 | CDD:275370 | 4/17 (24%) | ||
C2H2 Zn finger | 429..447 | CDD:275368 | 5/23 (22%) | ||
ZIK1 | NP_001010879.2 | KRAB | 27..>68 | CDD:214630 | |
KRAB | 27..66 | CDD:279668 | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 71..94 | ||||
C2H2 Zn finger | 215..233 | CDD:275368 | |||
C2H2 Zn finger | 241..261 | CDD:275368 | |||
zf-H2C2_2 | 253..278 | CDD:290200 | 4/11 (36%) | ||
COG5048 | <269..449 | CDD:227381 | 59/186 (32%) | ||
C2H2 Zn finger | 269..289 | CDD:275368 | 5/19 (26%) | ||
zf-H2C2_2 | 281..306 | CDD:290200 | 7/26 (27%) | ||
C2H2 Zn finger | 297..317 | CDD:275368 | 5/19 (26%) | ||
zf-H2C2_2 | 309..334 | CDD:290200 | 10/24 (42%) | ||
C2H2 Zn finger | 325..345 | CDD:275368 | 9/20 (45%) | ||
zf-H2C2_2 | 338..362 | CDD:290200 | 10/24 (42%) | ||
C2H2 Zn finger | 353..373 | CDD:275368 | 8/20 (40%) | ||
zf-H2C2_2 | 366..390 | CDD:290200 | 7/24 (29%) | ||
C2H2 Zn finger | 381..401 | CDD:275368 | 6/20 (30%) | ||
zf-H2C2_2 | 394..418 | CDD:290200 | 11/25 (44%) | ||
C2H2 Zn finger | 409..429 | CDD:275368 | 5/20 (25%) | ||
zf-H2C2_2 | 422..446 | CDD:290200 | 7/24 (29%) | ||
C2H2 Zn finger | 437..457 | CDD:275368 | 5/19 (26%) | ||
C2H2 Zn finger | 465..485 | CDD:275368 | 4/14 (29%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 1 | 1.050 | 104 | 1.000 | Inparanoid score | I4954 |
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.960 |