DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2116 and ZNF620

DIOPT Version :9

Sequence 1:NP_572444.2 Gene:CG2116 / 31735 FlyBaseID:FBgn0030003 Length:598 Species:Drosophila melanogaster
Sequence 2:XP_016861553.1 Gene:ZNF620 / 253639 HGNCID:28742 Length:467 Species:Homo sapiens


Alignment Length:398 Identity:94/398 - (23%)
Similarity:146/398 - (36%) Gaps:90/398 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 LGNEFEEDIIIVNENGVEKEML-----MSKELRDF--IVGSRVKDLTDDEQMPQFVVRELDMSEV 105
            :|.|....|...:|...|||.|     :|||...|  :||.          :|..|.:.||.   
Human   123 MGREALRGICPGDEARTEKEGLTPKDHVSKETESFRLMVGG----------LPGNVSQHLDF--- 174

  Fly   106 GDLVEVEPE-------MEQEADYGDYGDYEHEPSYGHPRDNERVEEDLDMYPPSSPSLPPSPPRP 163
            |..:| :|:       ..:...:.|.....|| :| ..::.|:.|: |......|..|..:...|
Human   175 GSSLE-QPQGHWIIKTKSKRRHFTDTSARHHE-AY-EVKNGEKFEK-LGKNISVSTQLTTNQTNP 235

  Fly   164 PSPV-----------VQPASKARNSARQIALRSFVSQKNNDDDDGSVKEVKPSEKMLEEFKGPRR 217
            ...:           :|.|...|:.......:||                        |.|...:
Human   236 SGQISYECGQCGRYFIQMADFHRHEKCHTGEKSF------------------------ECKECGK 276

  Fly   218 YMLFDDLIATIVDFDEDSTPLVEFSMISDIMDEKLPVECGIC-PDVMHKSKLSKHHKTHLVPGTN 281
            |..::.|             |:...:|.   ..|.|.:|..| ..:...:.|.:|.:.|  .|..
Human   277 YFRYNSL-------------LIRHQIIH---TGKKPFKCKECGKGLSSDTALIQHQRIH--TGEK 323

  Fly   282 RYACIYCTETYRDCKYLAGHARRHMGIRPYVCELCTLYFSTKQDLRVHNQRRHL-EKEHICEVCG 345
            .|.|..|.:.:........|.|.|.|.:.|.|..|...||......|| ||.|. ||.:.|:.||
Human   324 PYECKECGKAFSSSSVFLQHQRFHTGEKLYECNECWKTFSCSSSFTVH-QRMHTGEKPYECKECG 387

  Fly   346 KTFAQNTQLKRHREATHEKKRRFQCEYCQKAYYKNFSLQEHIRNVHMGKRRMLKCPFCGMQCRDA 410
            |..:.||.|.:| :..|..::.|:|:.|.||:.:..:|.:|.| ||.|: :..:|..||......
Human   388 KRLSSNTALTQH-QRIHTGEKPFECKECGKAFNQKITLIQHQR-VHTGE-KPYECKVCGKTFSWC 449

  Fly   411 HKMARHRK 418
            .:...|:|
Human   450 GRFILHQK 457

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2116NP_572444.2 C2H2 Zn finger 256..275 CDD:275368 4/19 (21%)
C2H2 Zn finger 285..305 CDD:275368 4/19 (21%)
PHA00733 <308..357 CDD:177301 19/49 (39%)
C2H2 Zn finger 313..334 CDD:275368 8/20 (40%)
C2H2 Zn finger 341..362 CDD:275368 8/20 (40%)
C2H2 Zn finger 370..388 CDD:275368 6/17 (35%)
C2H2 Zn finger 400..418 CDD:275370 4/17 (24%)
C2H2 Zn finger 429..447 CDD:275368
ZNF620XP_016861553.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.