DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2116 and sdz-12

DIOPT Version :9

Sequence 1:NP_572444.2 Gene:CG2116 / 31735 FlyBaseID:FBgn0030003 Length:598 Species:Drosophila melanogaster
Sequence 2:NP_494634.1 Gene:sdz-12 / 184388 WormBaseID:WBGene00017406 Length:330 Species:Caenorhabditis elegans


Alignment Length:248 Identity:59/248 - (23%)
Similarity:103/248 - (41%) Gaps:44/248 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   313 CELCTLYFSTKQDLRVHNQRRHL----------EKEHICEVCGKTFAQNTQLKRHREATHEKKRR 367
            |::|...|:.::.||.|  .:|:          ..:..||.|.|.|.....|||| :.||...:.
 Worm    29 CQVCKRKFANQKTLRTH--MKHITCRPGRSNVVNHKFRCENCEKQFTNKPNLKRH-QITHSGSKS 90

  Fly   368 FQCEYCQKAYYKNFSLQEHIRNVHMGKRRMLKCPF--CGMQC-----RDAHKMARHRKEMHLSQG 425
            .:|..||:.:::...||.|:.| |:.:|....||.  |.||.     .:.|.:..|    |.|..
 Worm    91 KKCSTCQRTFFREDQLQRHLHN-HLKERSHFDCPVLNCSMQFVFYEGVENHLVNHH----HFSYS 150

  Fly   426 -TYVCHLCQEEFTD-----ISYFDAHKRSIQ----CRSNTRRFVNADGNREGSDSE--SISGRNM 478
             :..|..|.:.|..     :.|...||.:::    ..:::.|......:..||...  :||.:..
 Worm   151 ESAPCGKCHKLFGSPRHLLVHYHFDHKEALRSSAPAPTSSARLSPITVSTSGSPRAQLAISPQEK 215

  Fly   479 NGQDDDYD-GMGPLQEEYDEDDGLLVEDNQPEEQGSPSNRQYLDESEQQYVQL 530
            ..|....: |..|:.||:.|.:...:.:.  ::|.||:    |..:|.::..|
 Worm   216 PPQKLSINLGTSPMIEEFCEQNSATLPNT--DQQLSPT----LSPNEPRFRNL 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2116NP_572444.2 C2H2 Zn finger 256..275 CDD:275368
C2H2 Zn finger 285..305 CDD:275368
PHA00733 <308..357 CDD:177301 14/53 (26%)
C2H2 Zn finger 313..334 CDD:275368 6/20 (30%)
C2H2 Zn finger 341..362 CDD:275368 9/20 (45%)
C2H2 Zn finger 370..388 CDD:275368 6/17 (35%)
C2H2 Zn finger 400..418 CDD:275370 7/24 (29%)
C2H2 Zn finger 429..447 CDD:275368 5/22 (23%)
sdz-12NP_494634.1 SFP1 <25..86 CDD:227516 17/59 (29%)
C2H2 Zn finger 29..48 CDD:275368 6/20 (30%)
COG5236 <32..>197 CDD:227561 42/172 (24%)
C2H2 Zn finger 65..85 CDD:275368 9/20 (45%)
C2H2 Zn finger 93..113 CDD:275368 7/20 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.