DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2116 and M03D4.4

DIOPT Version :9

Sequence 1:NP_572444.2 Gene:CG2116 / 31735 FlyBaseID:FBgn0030003 Length:598 Species:Drosophila melanogaster
Sequence 2:NP_001023313.1 Gene:M03D4.4 / 177375 WormBaseID:WBGene00019751 Length:505 Species:Caenorhabditis elegans


Alignment Length:433 Identity:95/433 - (21%)
Similarity:148/433 - (34%) Gaps:107/433 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   189 QKNNDDDDGSVKEVKPSEKMLEEFKGPRRYMLFDDLIATIVDFDEDSTPLVEFSMISDIMDEKLP 253
            |::..::..:|::....|..:|:         ..|.:|.|....|||..|.:.......|:...|
 Worm    21 QRHEREEHETVEQGDQEEDRMED---------DSDELAMIKIKIEDSDFLSDTDSSQLSMNPTTP 76

  Fly   254 VECGICPDVMHKSKLSKHHKTHLVPGTNRYACIYCTETYRDCKYLAGHARRHMGIRPYVCELCTL 318
            .|           |.|...|       .||.|..|.|.:...:.||.|.|.|.|.:|:.|..|..
 Worm    77 SE-----------KSSSGEK-------GRYECEDCHEMFAVKRELATHMRIHSGEQPHSCTQCGK 123

  Fly   319 YFSTKQDLRVHNQRRHLEKEHICEVCGKTFAQNTQLKRHREATHEKKRRFQCEYCQKAYYKNFSL 383
            .|.|:|.|:.|......|:.|:|..|.|.|.|...|.:|. ..|...|..:|..|.|.:...|.|
 Worm   124 EFGTRQLLKKHWMWHTGERSHVCPHCNKAFFQKGHLTQHL-MIHSGGRPHECPQCHKTFIFKFDL 187

  Fly   384 QEHIRNVHMGKRRMLKCPFCG-------------MQCR--------------------DAHKMAR 415
            ..|:: :|  :.|...|..||             ::|:                    .|..:..
 Worm   188 NRHMK-IH--QERGFSCQQCGRSFLKQVMLDEHHLKCKGKPSSPIRSLLTPTMKAGLESAISIKP 249

  Fly   416 HRKEMHLSQGTYVCHLCQEEFTDISYFDAHKRSIQCRSNTRRFVNADGNREGSDSESISGRNMNG 480
            .::.|.||..| :..:.|            |..||.:.|.|   ||.........|:|...|.|.
 Worm   250 PQESMILSSET-IAKMAQ------------KLLIQQQENHR---NALNTLLVKQHENILNNNNNN 298

  Fly   481 QDDDYDGMGPLQEEYDEDDGL-------------LVEDNQPEEQGSPSNRQYLDESEQQYVQLSD 532
            :.:..:|     ....:|.|.             ::..:|...|.|.:...|:.....|...|| 
 Worm   299 ESNILNG-----SVMHKDAGFEIPAPTIPLSLTCMICKSQFNSQPSFTLHMYMHHIANQNPNLS- 357

  Fly   533 YDDQHL-------LVENAVDAEDGGEDLDELLTEDQYFNAVQQ 568
            .|..|:       .:.:..|....|.|.| |.|:....::.|:
 Worm   358 IDSTHIHHTHQPTTISHQNDPTPLGSDSD-LATDTSCASSPQK 399

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2116NP_572444.2 C2H2 Zn finger 256..275 CDD:275368 3/18 (17%)
C2H2 Zn finger 285..305 CDD:275368 7/19 (37%)
PHA00733 <308..357 CDD:177301 16/48 (33%)
C2H2 Zn finger 313..334 CDD:275368 7/20 (35%)
C2H2 Zn finger 341..362 CDD:275368 7/20 (35%)
C2H2 Zn finger 370..388 CDD:275368 6/17 (35%)
C2H2 Zn finger 400..418 CDD:275370 5/50 (10%)
C2H2 Zn finger 429..447 CDD:275368 1/17 (6%)
M03D4.4NP_001023313.1 C2H2 Zn finger 90..110 CDD:275368 7/19 (37%)
zf-H2C2_2 102..127 CDD:290200 10/24 (42%)
C2H2 Zn finger 118..138 CDD:275368 7/19 (37%)
C2H2 Zn finger 146..166 CDD:275368 7/20 (35%)
zf-H2C2_2 158..181 CDD:290200 7/23 (30%)
zf-C2H2 172..194 CDD:278523 6/22 (27%)
C2H2 Zn finger 174..194 CDD:275368 6/20 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.