DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2116 and hinf-1

DIOPT Version :9

Sequence 1:NP_572444.2 Gene:CG2116 / 31735 FlyBaseID:FBgn0030003 Length:598 Species:Drosophila melanogaster
Sequence 2:NP_493579.2 Gene:hinf-1 / 173348 WormBaseID:WBGene00009553 Length:541 Species:Caenorhabditis elegans


Alignment Length:205 Identity:53/205 - (25%)
Similarity:85/205 - (41%) Gaps:26/205 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   249 DEKL--PVECGICPDVM-HKSKLSKHHKTHLVPGTNRYACIYCTETYRDCKYLAGHARRHMGIR- 309
            |:|:  |.:...|..|. .|:.|.:|.:.|  .|....||.:|...:.....|..|..|...:. 
 Worm   287 DKKVVFPCKWTACTQVADSKANLRRHARHH--SGEKVLACPFCARFFSRRDKLYDHCLRRTILMK 349

  Fly   310 ------PYVCELCTLYFSTKQDLRVHNQRRHLEKEHICEVCGKTFAQNTQLKRHREATHEKKRR- 367
                  ||:|:||...|.|::.|.:| ..||| ....|.:|........:|.||....|.::.: 
 Worm   350 NPEMEDPYLCKLCQKRFGTEKALCMH-VTRHL-VSLTCPLCSLGLGCRAELHRHLMTKHSRRSKD 412

  Fly   368 FQCEYCQKAYYKNFSLQEHI---RNVHMGKRRMLKCPFCGMQCRDAHKMARHRKE--MHLSQGTY 427
            |:|:.|.|.::....|..|.   .:|      |..|..|..:.:...::.:|.||  .:.:...|
 Worm   413 FKCDTCSKLFFTESELNRHAVYHSDV------MYSCKHCPEKFKWKKQLMKHMKEHDENFNPSPY 471

  Fly   428 VCHLCQEEFT 437
            .||||...:|
 Worm   472 TCHLCDRTYT 481

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2116NP_572444.2 C2H2 Zn finger 256..275 CDD:275368 5/19 (26%)
C2H2 Zn finger 285..305 CDD:275368 4/19 (21%)
PHA00733 <308..357 CDD:177301 15/55 (27%)
C2H2 Zn finger 313..334 CDD:275368 7/20 (35%)
C2H2 Zn finger 341..362 CDD:275368 5/20 (25%)
C2H2 Zn finger 370..388 CDD:275368 5/20 (25%)
C2H2 Zn finger 400..418 CDD:275370 3/17 (18%)
C2H2 Zn finger 429..447 CDD:275368 5/9 (56%)
hinf-1NP_493579.2 C2H2 Zn finger 299..316 CDD:275368 5/16 (31%)
C2H2 Zn finger 324..344 CDD:275368 4/19 (21%)
C2H2 Zn finger 359..379 CDD:275368 7/20 (35%)
C2H2 Zn finger 385..406 CDD:275368 5/20 (25%)
C2H2 Zn finger 415..435 CDD:275368 5/19 (26%)
C2H2 Zn finger 442..462 CDD:275368 4/19 (21%)
C2H2 Zn finger 473..494 CDD:275368 5/9 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.