DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG2116 and ZNF746

DIOPT Version :9

Sequence 1:	NP_572444.2	Gene:	CG2116 / 31735	FlyBaseID:	FBgn0030003	Length:	598	Species:	Drosophila melanogaster
Sequence 2:	NP_001381127.1	Gene:	ZNF746 / 155061	HGNCID:	21948	Length:	660	Species:	Homo sapiens

Alignment Length:	80	Identity:	27/80 - (33%)
Similarity:	36/80 - (45%)	Gaps:	5/80 - (6%)

- Green bases have known domain annotations that are detailed below.

  Fly   255 ECGICPDVMHKSKLSKHHKTHLVPGTNRYACIYCTETYRDCKYLAGHARRHMGIRPYVCELCTLY 319
            |||.|  ....:.|.:|...|  .|...:.|..|.:.:.:...|..|.|.|.|:||:.|.:|...
Human   530 ECGRC--FTRPAHLIRHRMLH--TGERPFPCTECEKRFTERSKLIDHYRTHTGVRPFTCTVCGKS 590

  Fly   320 FSTKQDLRVHNQRRH 334
            |..|..||.| ||.|
Human   591 FIRKDHLRKH-QRNH 604

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG2116	NP_572444.2	C2H2 Zn finger	256..275	CDD:275368	5/18 (28%)
		C2H2 Zn finger	285..305	CDD:275368	5/19 (26%)
		PHA00733	<308..357	CDD:177301	12/27 (44%)
		C2H2 Zn finger	313..334	CDD:275368	9/20 (45%)
		C2H2 Zn finger	341..362	CDD:275368
		C2H2 Zn finger	370..388	CDD:275368
		C2H2 Zn finger	400..418	CDD:275370
		C2H2 Zn finger	429..447	CDD:275368
ZNF746	NP_001381127.1	DUF3669	25..81	CDD:403575
		KRAB	111..171	CDD:214630
		zf-C2H2_11	522..548	CDD:406917	6/19 (32%)
		C2H2 Zn finger	528..548	CDD:275368	6/19 (32%)
		zf-H2C2_2	540..564	CDD:404364	6/25 (24%)
		C2H2 Zn finger	556..576	CDD:275368	5/19 (26%)
		zf-H2C2_2	569..593	CDD:404364	10/23 (43%)
		zf-C2H2	582..604	CDD:395048	9/22 (41%)
		C2H2 Zn finger	584..604	CDD:275368	9/20 (45%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	1	1.050	104	1.000	Inparanoid score	I4954
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	2	1.960