DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2116 and AgaP_AGAP009764

DIOPT Version :9

Sequence 1:NP_572444.2 Gene:CG2116 / 31735 FlyBaseID:FBgn0030003 Length:598 Species:Drosophila melanogaster
Sequence 2:XP_318852.2 Gene:AgaP_AGAP009764 / 1279172 VectorBaseID:AGAP009764 Length:154 Species:Anopheles gambiae


Alignment Length:199 Identity:49/199 - (24%)
Similarity:66/199 - (33%) Gaps:77/199 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   180 QIALRSFVSQKN---------NDDDDG--------------SVKEVKPSEKMLEEFKGPRRYMLF 221
            :.|:...|:|||         ||:.|.              ||...|..:.::....|.:||:  
Mosquito     8 EAAIPEAVTQKNDFVSKQLPSNDEGDAASSQPITKATPKSPSVGSTKSFQAIVTSSSGKKRYV-- 70

  Fly   222 DDLIATIVDFDEDSTPLVEFSMISDIMDEKLPVECGICPDVMHKSKLSKHHKTHLVPGTNRYACI 286
                     :|...|            ..|..|||.||    ||.          :|.|.     
Mosquito    71 ---------YDCKQT------------YRKQLVECAIC----HKK----------LPKTR----- 95

  Fly   287 YCTETYRDCKYLAGHARRHMGIRPYVCEL-CTLYFSTKQDLRVHNQRRHLEKEHICEVCGKTFAQ 350
                       |.||...|:|:||:.||. |...|..||.|..|.:..|..:.|.|:||||....
Mosquito    96 -----------LDGHRNVHLGLRPWNCERGCEQRFHCKQLLLHHYRNVHNGEAHCCDVCGKVLRS 149

  Fly   351 NTQL 354
            ...|
Mosquito   150 KRSL 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2116NP_572444.2 C2H2 Zn finger 256..275 CDD:275368 5/18 (28%)
C2H2 Zn finger 285..305 CDD:275368 3/19 (16%)
PHA00733 <308..357 CDD:177301 18/48 (38%)
C2H2 Zn finger 313..334 CDD:275368 8/21 (38%)
C2H2 Zn finger 341..362 CDD:275368 6/14 (43%)
C2H2 Zn finger 370..388 CDD:275368
C2H2 Zn finger 400..418 CDD:275370
C2H2 Zn finger 429..447 CDD:275368
AgaP_AGAP009764XP_318852.2 C2H2 Zn finger 84..103 CDD:275368 10/48 (21%)
C2H2 Zn finger 111..133 CDD:275368 8/21 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.