Sequence 1: | NP_572444.2 | Gene: | CG2116 / 31735 | FlyBaseID: | FBgn0030003 | Length: | 598 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_318852.2 | Gene: | AgaP_AGAP009764 / 1279172 | VectorBaseID: | AGAP009764 | Length: | 154 | Species: | Anopheles gambiae |
Alignment Length: | 199 | Identity: | 49/199 - (24%) |
---|---|---|---|
Similarity: | 66/199 - (33%) | Gaps: | 77/199 - (38%) |
- Green bases have known domain annotations that are detailed below.
Fly 180 QIALRSFVSQKN---------NDDDDG--------------SVKEVKPSEKMLEEFKGPRRYMLF 221
Fly 222 DDLIATIVDFDEDSTPLVEFSMISDIMDEKLPVECGICPDVMHKSKLSKHHKTHLVPGTNRYACI 286
Fly 287 YCTETYRDCKYLAGHARRHMGIRPYVCEL-CTLYFSTKQDLRVHNQRRHLEKEHICEVCGKTFAQ 350
Fly 351 NTQL 354 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG2116 | NP_572444.2 | C2H2 Zn finger | 256..275 | CDD:275368 | 5/18 (28%) |
C2H2 Zn finger | 285..305 | CDD:275368 | 3/19 (16%) | ||
PHA00733 | <308..357 | CDD:177301 | 18/48 (38%) | ||
C2H2 Zn finger | 313..334 | CDD:275368 | 8/21 (38%) | ||
C2H2 Zn finger | 341..362 | CDD:275368 | 6/14 (43%) | ||
C2H2 Zn finger | 370..388 | CDD:275368 | |||
C2H2 Zn finger | 400..418 | CDD:275370 | |||
C2H2 Zn finger | 429..447 | CDD:275368 | |||
AgaP_AGAP009764 | XP_318852.2 | C2H2 Zn finger | 84..103 | CDD:275368 | 10/48 (21%) |
C2H2 Zn finger | 111..133 | CDD:275368 | 8/21 (38%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |