DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2116 and ZNF689

DIOPT Version :9

Sequence 1:NP_572444.2 Gene:CG2116 / 31735 FlyBaseID:FBgn0030003 Length:598 Species:Drosophila melanogaster
Sequence 2:NP_612456.1 Gene:ZNF689 / 115509 HGNCID:25173 Length:500 Species:Homo sapiens


Alignment Length:404 Identity:90/404 - (22%)
Similarity:145/404 - (35%) Gaps:90/404 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   124 YGDYEHEPSYGH----------PRDNERVEEDLDMYPPSSPSLPPSPPR---------------- 162
            |.|...| :|||          |.....:|.:.|.:.|::.. |...||                
Human    54 YRDVMRE-TYGHLGALGCAGPKPALISWLERNTDDWEPAALD-PQEYPRGLTVQRKSRTRKKNGE 116

  Fly   163 ----PPSPVVQPASKARNSARQIALRSFVSQKNNDDDDGSV---KEVKPSEKMLEEFKGP----- 215
                ||....:...:.|..::...:....|......|.|..   .:...|.|..:..|.|     
Human   117 KEVFPPKEAPRKGKRGRRPSKPRLIPRQTSGGPICPDCGCTFPDHQALESHKCAQNLKKPYPCPD 181

  Fly   216 --RRYMLFDDLIATIVDFDEDSTPLV------EFSMISDIMDEKL------PVECGICPDVMHKS 266
              ||:. :..|:.:.........|.|      .||...::...::      |..|..|.....:|
Human   182 CGRRFS-YPSLLVSHRRAHSGECPYVCDQCGKRFSQRKNLSQHQVIHTGEKPYHCPDCGRCFRRS 245

  Fly   267 K-LSKHHKTHLVPGTNRYACIYCTETYRDCKYLAGHARRHMGIRPYVCELCTLYFSTKQDLRVHN 330
            : |:.|..||  .|...:.|..|...:.....||.|.|.|.|.:||.|..|...|..:..|.:| 
Human   246 RSLANHRTTH--TGEKPHQCPSCGRRFAYPSLLAIHQRTHTGEKPYTCLECNRRFRQRTALVIH- 307

  Fly   331 QRRHL-EKEHICEVCGKTFAQNTQLKRHREATHEKKRRFQCEYCQKAYYKNFSLQEHIRNVHMGK 394
            ||.|. ||.:.|..|.:.|:.:::|..||. .|..:|.:.||:|:..:.:..:|.:| :.:|.|:
Human   308 QRIHTGEKPYPCPDCERRFSSSSRLVSHRR-VHSGERPYACEHCEARFSQRSTLLQH-QLLHTGE 370

  Fly   395 RRMLKCPFCGMQCRDAHKMARHR---------------------------KEMHLSQGTYVCHLC 432
             :...||.||...|.:..:|.||                           :.:|..:..|.|.||
Human   371 -KPYPCPDCGRAFRRSGSLAIHRSTHTEEKLHACDDCGRRFAYPSLLASHRRVHSGERPYACDLC 434

  Fly   433 QEEFTDISYFDAHK 446
            .:.|...|:...|:
Human   435 SKRFAQWSHLAQHQ 448

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2116NP_572444.2 C2H2 Zn finger 256..275 CDD:275368 5/19 (26%)
C2H2 Zn finger 285..305 CDD:275368 6/19 (32%)
PHA00733 <308..357 CDD:177301 16/49 (33%)
C2H2 Zn finger 313..334 CDD:275368 7/20 (35%)
C2H2 Zn finger 341..362 CDD:275368 6/20 (30%)
C2H2 Zn finger 370..388 CDD:275368 5/17 (29%)
C2H2 Zn finger 400..418 CDD:275370 8/44 (18%)
C2H2 Zn finger 429..447 CDD:275368 6/18 (33%)
ZNF689NP_612456.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..25
KRAB 29..88 CDD:214630 9/34 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 90..146 7/56 (13%)
C2H2 Zn finger 151..171 CDD:275368 4/19 (21%)
COG5048 159..>466 CDD:227381 71/297 (24%)
C2H2 Zn finger 179..199 CDD:275368 3/20 (15%)
C2H2 Zn finger 207..227 CDD:275368 2/19 (11%)
C2H2 Zn finger 235..255 CDD:275368 5/19 (26%)
C2H2 Zn finger 263..283 CDD:275368 6/19 (32%)
C2H2 Zn finger 291..311 CDD:275368 7/20 (35%)
C2H2 Zn finger 319..339 CDD:275368 6/20 (30%)
C2H2 Zn finger 347..367 CDD:275368 5/20 (25%)
C2H2 Zn finger 375..395 CDD:275368 8/19 (42%)
C2H2 Zn finger 403..423 CDD:275368 0/19 (0%)
C2H2 Zn finger 431..451 CDD:275368 6/18 (33%)
C2H2 Zn finger 459..475 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.