DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2116 and Zfp78

DIOPT Version :9

Sequence 1:NP_572444.2 Gene:CG2116 / 31735 FlyBaseID:FBgn0030003 Length:598 Species:Drosophila melanogaster
Sequence 2:XP_017445447.1 Gene:Zfp78 / 103690110 RGDID:1586242 Length:638 Species:Rattus norvegicus


Alignment Length:279 Identity:75/279 - (26%)
Similarity:116/279 - (41%) Gaps:44/279 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   231 FDEDSTPLVEFSMISDIMDEKLPVECGICPDV----MHKSKLSKHHKTHLVP------------- 278
            |.:.||    |:......::|.|.:|..|...    |..::.|:|:.|...|             
  Rat   327 FRDSST----FAQHKRCHNDKRPFQCAECGQAFRYNMSLTRHSRHYHTGEKPFDCADCGKVFSVH 387

  Fly   279 -----------GTNRYACIYCTETYRDCKYLAGHARRHMGIRPYVCELCTLYFSTKQDLRVHNQR 332
                       |...|.|..|.:.:|....|..|.|.|.|.:||.|::|...||....|..|.:.
  Rat   388 IGLTLHRRIHTGEKPYPCNVCGKAFRSGSSLTVHHRIHTGEKPYKCDICGKAFSHSMSLTGHQRV 452

  Fly   333 RHLEKEHICEVCGKTFAQNTQLKRHREATHEKKRRFQCEYCQKAYYKNFSLQEHIRNVHMGKRRM 397
            ...||.:.|:.|||.|.|:..|..| ...|..::.::|:.|.||:.::..|..|.|| |.|: :.
  Rat   453 HSGEKPYTCKECGKAFRQSIHLVVH-SRIHTGEKPYECKECGKAFRESSQLASHQRN-HTGE-KP 514

  Fly   398 LKCPFCGMQCRDAHKMARHRKEMHLSQGTYVCHLCQEEFTDISYFDAHKR------SIQCRSNTR 456
            .:|..||...:.:..:|||:| :|..:..|.|:.|.:.||..:|...|||      ..:|....:
  Rat   515 FECKQCGKFFKRSTYLARHQK-IHTGEKPYECNECGKTFTHTAYLIRHKRVHTGEKPYKCSECGK 578

  Fly   457 RFVNADGNREGSDSESISG 475
            .|  .||:.........||
  Rat   579 AF--GDGSSRAQHQRLHSG 595

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2116NP_572444.2 C2H2 Zn finger 256..275 CDD:275368 5/22 (23%)
C2H2 Zn finger 285..305 CDD:275368 6/19 (32%)
PHA00733 <308..357 CDD:177301 17/48 (35%)
C2H2 Zn finger 313..334 CDD:275368 6/20 (30%)
C2H2 Zn finger 341..362 CDD:275368 8/20 (40%)
C2H2 Zn finger 370..388 CDD:275368 6/17 (35%)
C2H2 Zn finger 400..418 CDD:275370 6/17 (35%)
C2H2 Zn finger 429..447 CDD:275368 6/17 (35%)
Zfp78XP_017445447.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.