DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2116 and znf1053

DIOPT Version :9

Sequence 1:NP_572444.2 Gene:CG2116 / 31735 FlyBaseID:FBgn0030003 Length:598 Species:Drosophila melanogaster
Sequence 2:XP_017211055.1 Gene:znf1053 / 100150608 ZFINID:ZDB-GENE-121214-1 Length:448 Species:Danio rerio


Alignment Length:196 Identity:56/196 - (28%)
Similarity:94/196 - (47%) Gaps:7/196 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   253 PVECGICPDVMHKSKLSK-HHKTHLVPGTNRYACIYCTETYRDCKYLAGHARRHMGIRPYVCELC 316
            |..|..|.....:.:..| |.:.|  .|.:::.|..|.:::......|.|.|.|.|.:|:.|:.|
Zfish   109 PYTCKQCGKSFSQIQGFKVHMRIH--TGESKFTCQECGKSFYHAGNFAAHMRIHTGEKPFSCKQC 171

  Fly   317 TLYFSTKQDLRVHNQRRHLEKEHICEVCGKTFAQNTQLKRHREATHEKKRRFQCEYCQKAYYKNF 381
            ...||.|.:|.:|.:....||...|:.|||:|:|.:.|..|.. .|..::.:.||.|.:::.:..
Zfish   172 GKSFSQKPNLDIHMRIHTGEKPFSCKQCGKSFSQKSHLDIHMR-VHTGEKPYTCEQCGQSFSQKQ 235

  Fly   382 SLQEHIRNVHMGKRRMLKCPFCGMQCRDAHKMARHRKEMHLSQGTYVCHLCQEEFTDISYFDAHK 446
            |.:.|:| :|.|: |...|..||...|.|..:|.|.: :|..:..:.|..|.:.|:..:...||.
Zfish   236 SFKSHMR-IHTGE-RPYTCQQCGKNFRHARNLAAHMR-IHTGEKPFSCKQCGKSFSKKANLIAHM 297

  Fly   447 R 447
            |
Zfish   298 R 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2116NP_572444.2 C2H2 Zn finger 256..275 CDD:275368 4/19 (21%)
C2H2 Zn finger 285..305 CDD:275368 5/19 (26%)
PHA00733 <308..357 CDD:177301 17/48 (35%)
C2H2 Zn finger 313..334 CDD:275368 7/20 (35%)
C2H2 Zn finger 341..362 CDD:275368 8/20 (40%)
C2H2 Zn finger 370..388 CDD:275368 5/17 (29%)
C2H2 Zn finger 400..418 CDD:275370 7/17 (41%)
C2H2 Zn finger 429..447 CDD:275368 5/17 (29%)
znf1053XP_017211055.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.