Sequence 1: | NP_572444.2 | Gene: | CG2116 / 31735 | FlyBaseID: | FBgn0030003 | Length: | 598 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_017211055.1 | Gene: | znf1053 / 100150608 | ZFINID: | ZDB-GENE-121214-1 | Length: | 448 | Species: | Danio rerio |
Alignment Length: | 196 | Identity: | 56/196 - (28%) |
---|---|---|---|
Similarity: | 94/196 - (47%) | Gaps: | 7/196 - (3%) |
- Green bases have known domain annotations that are detailed below.
Fly 253 PVECGICPDVMHKSKLSK-HHKTHLVPGTNRYACIYCTETYRDCKYLAGHARRHMGIRPYVCELC 316
Fly 317 TLYFSTKQDLRVHNQRRHLEKEHICEVCGKTFAQNTQLKRHREATHEKKRRFQCEYCQKAYYKNF 381
Fly 382 SLQEHIRNVHMGKRRMLKCPFCGMQCRDAHKMARHRKEMHLSQGTYVCHLCQEEFTDISYFDAHK 446
Fly 447 R 447 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG2116 | NP_572444.2 | C2H2 Zn finger | 256..275 | CDD:275368 | 4/19 (21%) |
C2H2 Zn finger | 285..305 | CDD:275368 | 5/19 (26%) | ||
PHA00733 | <308..357 | CDD:177301 | 17/48 (35%) | ||
C2H2 Zn finger | 313..334 | CDD:275368 | 7/20 (35%) | ||
C2H2 Zn finger | 341..362 | CDD:275368 | 8/20 (40%) | ||
C2H2 Zn finger | 370..388 | CDD:275368 | 5/17 (29%) | ||
C2H2 Zn finger | 400..418 | CDD:275370 | 7/17 (41%) | ||
C2H2 Zn finger | 429..447 | CDD:275368 | 5/17 (29%) | ||
znf1053 | XP_017211055.1 | None |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |