DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2116 and ZNF705G

DIOPT Version :9

Sequence 1:NP_572444.2 Gene:CG2116 / 31735 FlyBaseID:FBgn0030003 Length:598 Species:Drosophila melanogaster
Sequence 2:NP_001157929.1 Gene:ZNF705G / 100131980 HGNCID:37134 Length:300 Species:Homo sapiens


Alignment Length:209 Identity:57/209 - (27%)
Similarity:93/209 - (44%) Gaps:16/209 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   232 DEDSTPLVEFSMISDIMDEKLPVECGIC-PDVMHKSKLSKHHKTHLVPGTNRYACIYCTETYRDC 295
            |..::..:|.|:|.:.     |.||... .|....|.:::...||  .|...|....|.::.|:.
Human    99 DASTSMTMENSLILED-----PFECNDSGEDCTRSSTITQCLLTH--SGKKPYVSKQCGKSLRNL 156

  Fly   296 KYLAGHARRHMGIRPYVCELCTLYFSTKQDLRVHNQRRHLEKEHICEVCGKTFAQNTQLKRHREA 360
            .....|.:.|...:.|.|.||...::....||.|......|:.:.|.:|.|.|.|.:.|:|| |.
Human   157 LSTEPHKQIHTKGKSYQCNLCEKAYTNCFHLRRHKMTHTGERPYACHLCRKAFTQCSHLRRH-EK 220

  Fly   361 THEKKRRFQCEYCQKAYYKNFSLQEHIRNVHMGKRRMLKCPFCGMQCRDAHKMA--RHRKEMHLS 423
            ||..:|.::|....|.:.::|:||.|.| .|:||    ||..|....:...:.:  |..|.:|..
Human   221 THTGQRPYKCHQYGKVFIQSFNLQRHER-THLGK----KCYECDKSGKAFSQSSGFRGNKIIHTG 280

  Fly   424 QGTYVCHLCQEEFT 437
            :..:.|.||.:.|:
Human   281 EKPHACLLCGKAFS 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2116NP_572444.2 C2H2 Zn finger 256..275 CDD:275368 3/19 (16%)
C2H2 Zn finger 285..305 CDD:275368 3/19 (16%)
PHA00733 <308..357 CDD:177301 14/48 (29%)
C2H2 Zn finger 313..334 CDD:275368 6/20 (30%)
C2H2 Zn finger 341..362 CDD:275368 9/20 (45%)
C2H2 Zn finger 370..388 CDD:275368 6/17 (35%)
C2H2 Zn finger 400..418 CDD:275370 3/19 (16%)
C2H2 Zn finger 429..447 CDD:275368 4/9 (44%)
ZNF705GNP_001157929.1 KRAB 7..66 CDD:214630
KRAB 7..46 CDD:279668
COG5048 <92..246 CDD:227381 42/154 (27%)
C2H2 Zn finger 118..138 CDD:275368 3/19 (16%)
C2H2 Zn finger 147..166 CDD:275368 3/18 (17%)
C2H2 Zn finger 174..194 CDD:275368 6/19 (32%)
zf-H2C2_2 186..211 CDD:290200 8/24 (33%)
C2H2 Zn finger 202..222 CDD:275368 9/20 (45%)
zf-H2C2_2 214..239 CDD:290200 9/25 (36%)
C2H2 Zn finger 230..250 CDD:275368 7/20 (35%)
C2H2 Zn finger 258..278 CDD:275368 3/19 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 104 1.000 Inparanoid score I4954
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.