Sequence 1: | NP_572444.2 | Gene: | CG2116 / 31735 | FlyBaseID: | FBgn0030003 | Length: | 598 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001157929.1 | Gene: | ZNF705G / 100131980 | HGNCID: | 37134 | Length: | 300 | Species: | Homo sapiens |
Alignment Length: | 209 | Identity: | 57/209 - (27%) |
---|---|---|---|
Similarity: | 93/209 - (44%) | Gaps: | 16/209 - (7%) |
- Green bases have known domain annotations that are detailed below.
Fly 232 DEDSTPLVEFSMISDIMDEKLPVECGIC-PDVMHKSKLSKHHKTHLVPGTNRYACIYCTETYRDC 295
Fly 296 KYLAGHARRHMGIRPYVCELCTLYFSTKQDLRVHNQRRHLEKEHICEVCGKTFAQNTQLKRHREA 360
Fly 361 THEKKRRFQCEYCQKAYYKNFSLQEHIRNVHMGKRRMLKCPFCGMQCRDAHKMA--RHRKEMHLS 423
Fly 424 QGTYVCHLCQEEFT 437 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG2116 | NP_572444.2 | C2H2 Zn finger | 256..275 | CDD:275368 | 3/19 (16%) |
C2H2 Zn finger | 285..305 | CDD:275368 | 3/19 (16%) | ||
PHA00733 | <308..357 | CDD:177301 | 14/48 (29%) | ||
C2H2 Zn finger | 313..334 | CDD:275368 | 6/20 (30%) | ||
C2H2 Zn finger | 341..362 | CDD:275368 | 9/20 (45%) | ||
C2H2 Zn finger | 370..388 | CDD:275368 | 6/17 (35%) | ||
C2H2 Zn finger | 400..418 | CDD:275370 | 3/19 (16%) | ||
C2H2 Zn finger | 429..447 | CDD:275368 | 4/9 (44%) | ||
ZNF705G | NP_001157929.1 | KRAB | 7..66 | CDD:214630 | |
KRAB | 7..46 | CDD:279668 | |||
COG5048 | <92..246 | CDD:227381 | 42/154 (27%) | ||
C2H2 Zn finger | 118..138 | CDD:275368 | 3/19 (16%) | ||
C2H2 Zn finger | 147..166 | CDD:275368 | 3/18 (17%) | ||
C2H2 Zn finger | 174..194 | CDD:275368 | 6/19 (32%) | ||
zf-H2C2_2 | 186..211 | CDD:290200 | 8/24 (33%) | ||
C2H2 Zn finger | 202..222 | CDD:275368 | 9/20 (45%) | ||
zf-H2C2_2 | 214..239 | CDD:290200 | 9/25 (36%) | ||
C2H2 Zn finger | 230..250 | CDD:275368 | 7/20 (35%) | ||
C2H2 Zn finger | 258..278 | CDD:275368 | 3/19 (16%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 1 | 1.050 | 104 | 1.000 | Inparanoid score | I4954 |
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.050 |