DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2116 and ZNF705E

DIOPT Version :9

Sequence 1:NP_572444.2 Gene:CG2116 / 31735 FlyBaseID:FBgn0030003 Length:598 Species:Drosophila melanogaster
Sequence 2:NP_001265642.1 Gene:ZNF705E / 100131539 HGNCID:33203 Length:300 Species:Homo sapiens


Alignment Length:261 Identity:63/261 - (24%)
Similarity:110/261 - (42%) Gaps:43/261 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   184 RSFVSQKNNDDDDGSVKEVKPSEKMLEEFKGPRRYMLFDDLIATIVDFDEDSTPLVEFSMISDIM 248
            |.|: |..|.|.:.::|               :.:|:   .:..|:..|..::..:|.|:|.:. 
Human    70 REFL-QDQNPDRESALK---------------KTHMI---SMHPIIRKDAPTSMTMENSLILED- 114

  Fly   249 DEKLPVECGIC-PDVMHKSKLSKHHKTHLVPGTNRYACIYCTETYRDCKYLAGHARRHMGIRPYV 312
                |.||... .|..|.|.:.:...||  .|...|....|.::..:......|.:.|...:.|.
Human   115 ----PFECNDSGEDCTHSSTIIQCLLTH--SGKKPYVSKQCGKSLSNLLSPKPHKQIHTKGKSYQ 173

  Fly   313 CELCTLYFSTKQDLRVHNQRRHLEKEHICEVCGKTFAQNTQLKRHREATHEKKRRFQCEYCQKAY 377
            |.||...::....||........|:.:.|.:|.|.|.|.:.|:|| |.||..:|.::|..|.||:
Human   174 CNLCEKAYTNCFHLRRPKMTHTGERPYTCHLCRKAFTQCSHLRRH-EKTHTGERPYKCHQCGKAF 237

  Fly   378 YKNFSLQEHIRNVHMGKRRMLKCPFCGMQCRDAHKM------ARHRKEMHLSQGTYVCHLCQEEF 436
            .::|:|:.|.| .|:|::        ..:|.::.|.      .|..|.:|..:..:.|.||.:.|
Human   238 IQSFNLRRHER-THLGEK--------WYECDNSGKAFSQSSGFRGNKIIHTGEKPHACLLCGKAF 293

  Fly   437 T 437
            :
Human   294 S 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2116NP_572444.2 C2H2 Zn finger 256..275 CDD:275368 4/19 (21%)
C2H2 Zn finger 285..305 CDD:275368 2/19 (11%)
PHA00733 <308..357 CDD:177301 13/48 (27%)
C2H2 Zn finger 313..334 CDD:275368 5/20 (25%)
C2H2 Zn finger 341..362 CDD:275368 9/20 (45%)
C2H2 Zn finger 370..388 CDD:275368 7/17 (41%)
C2H2 Zn finger 400..418 CDD:275370 3/23 (13%)
C2H2 Zn finger 429..447 CDD:275368 4/9 (44%)
ZNF705ENP_001265642.1 KRAB 7..66 CDD:214630
C2H2 Zn finger 118..138 CDD:275368 4/19 (21%)
C2H2 Zn finger 147..166 CDD:275368 2/18 (11%)
C2H2 Zn finger 174..194 CDD:275368 5/19 (26%)
C2H2 Zn finger 202..222 CDD:275368 9/20 (45%)
zf-H2C2_2 214..239 CDD:316026 11/25 (44%)
C2H2 Zn finger 230..250 CDD:275368 8/20 (40%)
C2H2 Zn finger 258..278 CDD:275368 4/19 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 104 1.000 Inparanoid score I4954
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.