DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2116 and ZSCAN30

DIOPT Version :9

Sequence 1:NP_572444.2 Gene:CG2116 / 31735 FlyBaseID:FBgn0030003 Length:598 Species:Drosophila melanogaster
Sequence 2:NP_001106205.1 Gene:ZSCAN30 / 100101467 HGNCID:33517 Length:494 Species:Homo sapiens


Alignment Length:505 Identity:117/505 - (23%)
Similarity:195/505 - (38%) Gaps:103/505 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 YSDEDNRGNVRVINTSDDATYVLLDNLGNEFEEDIIIVNENGVEKEMLMSKELRDFIVG------ 80
            ::.|:..| :.|:...:: .|||..:.|         :.||...:|:...| .|.|...      
Human    11 HAPEEQEG-LLVVKVEEE-NYVLDQDFG---------LQENPWSQEVFRQK-FRQFSYSDSTGPR 63

  Fly    81 ---SRVKDLTDDEQMPQFVVRE--LDMSEVGDLVEVEPEMEQEADYGDYGDYEHEPSYGHPRDN- 139
               ||:::|......|:...:|  |::..:...:.:.|| |.:|..     .||.|..|..... 
Human    64 EALSRLRELCCQWLRPEVHSKEQILELLMLEQFLAILPE-ELQAWL-----REHRPENGEEAVTM 122

  Fly   140 -ERVEEDL------------DMYPPSSPSLPPSPPRPPSPVVQP----------ASKA--RNSAR 179
             |.:|::|            :|:.....|.........:..|||          .|:|  ....|
Human   123 LEELEKELEEPRQQDTTHGQEMFWQEMTSTGALKSLSLNSPVQPLENQCKTETQESQAFQERDGR 187

  Fly   180 QIALRSFVSQKNNDDDDGSVKEVKP--------SEKMLEEFKG---------------------- 214
            .:|.:..::::...:...|...:.|        |:::.||..|                      
Human   188 MVAGKVLMAKQEIVECVASAAMISPGKLPGETHSQRIAEEALGGLDNSKKQKGNAAGNKISQLPS 252

  Fly   215 -PRRYML--FDDLIATIVDFDEDSTPLVEFSMIS-DIMD------EKLPVECGICPDVM-HKSKL 268
             .|.:.|  |:..|.|.....|.......|||.| ||..      ||| .||..|.... ..|||
Human   253 QDRHFSLATFNRRIPTEHSVLESHESEGSFSMNSNDITQQSVDTREKL-YECFDCGKAFCQSSKL 316

  Fly   269 SKHHKTHLVPGTNRYACIYCTETYRDCKYLAGHARRHMGIRPYVCELCTLYFSTKQDLRVHNQRR 333
            .:|.:.|  .|...|||..|.:.:.....|..|.|.|.|.:||.|..|...|....:|..|.:..
Human   317 IRHQRIH--TGERPYACKECGKAFSLSSDLVRHQRIHSGEKPYECCECGKAFRGSSELIRHRRIH 379

  Fly   334 HLEKEHICEVCGKTFAQNTQLKRHREATHEKKRRFQCEYCQKAYYKNFSLQEHIRNVHMGKRRML 398
            ..||.:.|..|||.|::::.|.:|:: .|...:.::|..|.||:.::..|.||.| :|.|: :..
Human   380 TGEKPYECGECGKAFSRSSALIQHKK-IHTGDKSYECIACGKAFGRSSILIEHQR-IHTGE-KPY 441

  Fly   399 KCPFCGMQCRDAHKMARHRKEMHLSQGTYVCHLCQEEFTDISYFDAHKRS 448
            :|..||.....:..:.:|:: :|..:..|.|..|::.|...|....|:|:
Human   442 ECNECGKSFNQSSALTQHQR-IHTGEKPYECSECRKTFRHRSGLMQHQRT 490

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2116NP_572444.2 C2H2 Zn finger 256..275 CDD:275368 6/19 (32%)
C2H2 Zn finger 285..305 CDD:275368 5/19 (26%)
PHA00733 <308..357 CDD:177301 15/48 (31%)
C2H2 Zn finger 313..334 CDD:275368 5/20 (25%)
C2H2 Zn finger 341..362 CDD:275368 7/20 (35%)
C2H2 Zn finger 370..388 CDD:275368 7/17 (41%)
C2H2 Zn finger 400..418 CDD:275370 4/17 (24%)
C2H2 Zn finger 429..447 CDD:275368 5/17 (29%)
ZSCAN30NP_001106205.1 SCAN 44..154 CDD:128708 23/116 (20%)
SCAN 44..122 CDD:280241 18/84 (21%)
COG5048 281..>360 CDD:227381 29/81 (36%)
zf-C2H2 301..323 CDD:278523 7/21 (33%)
C2H2 Zn finger 303..323 CDD:275368 6/19 (32%)
zf-H2C2_2 316..339 CDD:290200 8/24 (33%)
COG5048 <328..479 CDD:227381 44/154 (29%)
C2H2 Zn finger 331..351 CDD:275368 5/19 (26%)
zf-H2C2_2 343..366 CDD:290200 9/22 (41%)
C2H2 Zn finger 359..379 CDD:275368 5/19 (26%)
zf-H2C2_2 371..396 CDD:290200 9/24 (38%)
C2H2 Zn finger 387..407 CDD:275368 7/20 (35%)
zf-H2C2_2 399..424 CDD:290200 7/25 (28%)
C2H2 Zn finger 415..435 CDD:275368 8/20 (40%)
zf-H2C2_2 428..452 CDD:290200 9/25 (36%)
C2H2 Zn finger 443..463 CDD:275368 4/20 (20%)
zf-H2C2_2 455..480 CDD:290200 6/25 (24%)
C2H2 Zn finger 471..491 CDD:275368 6/20 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.