DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cyr and qsm

DIOPT Version :9

Sequence 1:NP_001285004.1 Gene:cyr / 31733 FlyBaseID:FBgn0030001 Length:513 Species:Drosophila melanogaster
Sequence 2:NP_001286637.1 Gene:qsm / 47065 FlyBaseID:FBgn0028622 Length:414 Species:Drosophila melanogaster


Alignment Length:318 Identity:66/318 - (20%)
Similarity:115/318 - (36%) Gaps:97/318 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 QVNCSRELLEMHLELSRPFRGLLYAKDFPLECRARGKDSTRLHLR----IPTSGCGVRAEPLEDG 132
            :|:||.:  :|.:::..|            :..::.:.:.:::|.    .|...|    :|..||
  Fly    28 KVHCSED--QMRVDIGLP------------DAESKDQSAPQIYLEGLKGYPDERC----QPQIDG 74

  Fly   133 SLEY------------TVRVMLQKEQK-------LRQSTD--ILSSVRCQLPA----NAMGMPLP 172
            ||..            ..|::.|...|       :.:||.  .:.||:|...|    |.|     
  Fly    75 SLAVFRLSLSDFYECGVTRMVNQLTGKKVYYHKIIIESTSGKEIVSVKCITTASPAYNVM----- 134

  Fly   173 VLRQEKGHDRNAR----MRALAAAAAVPA-------LGATSSINQQQRETPRVRIWLELGGPNGT 226
             :....|....:.    :..|.....:||       |..|:|:.::..| ||:.|.:...|...|
  Fly   135 -MNATTGSSSTSTSSGGIHGLVKRDVLPAGFQEPEDLEITTSLTKRAPE-PRLSIGVSQDGQKFT 197

  Fly   227 GSVEVGVATTLTVRAIVPGNIGVRVVDCAALDGLG---------ESTQQLLDARGCPIDEQVMPA 282
            ..:.|...|.||:..    |:.   .|.|.:.|||         .::.:.|..:||.:|..:...
  Fly   198 RDLTVKSGTPLTMEI----NLD---EDSAPVYGLGVNYLDVTDTHTSSETLIFKGCTVDPYLFEN 255

  Fly   283 LHTQHRPAEEGWSKQHEEDLVERTFAATFPAFKFPDRERLHVSCGVQLCKGKCPTLNC 340
            .:|            .:.|::    :|.|.||||||...:.....|.:|..||....|
  Fly   256 FNT------------IDGDIL----SAKFKAFKFPDSSYVQFRATVNVCLDKCLGTQC 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cyrNP_001285004.1 ZP 82..344 CDD:214579 63/308 (20%)
qsmNP_001286637.1 ZP 30..298 CDD:214579 65/316 (21%)
Zona_pellucida <200..300 CDD:278526 29/121 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45473243
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.