DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cyr and dyl

DIOPT Version :9

Sequence 1:NP_001285004.1 Gene:cyr / 31733 FlyBaseID:FBgn0030001 Length:513 Species:Drosophila melanogaster
Sequence 2:NP_647890.2 Gene:dyl / 38531 FlyBaseID:FBgn0066365 Length:611 Species:Drosophila melanogaster


Alignment Length:372 Identity:82/372 - (22%)
Similarity:137/372 - (36%) Gaps:121/372 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 TTTKTMQIQAMQVNCSRELLEMHLELSRPFRGLLYAKDFPLECRARGKDSTRLHLRIPTSG---- 121
            :|..:.||:.:||.|.:..:.:::|..|||.|::::|.|       ..|...:||: |.:|    
  Fly    77 STNDSPQIKHLQVQCEKTHMRVNIEFDRPFYGMIFSKGF-------YSDPHCVHLK-PGTGHLSA 133

  Fly   122 --------CGVRAE----------PLEDGS-LEYTVRVMLQKEQKLRQSTDILSSVRCQLPANAM 167
                    ||:.:.          |...|| :|.|  :::|.:..:::..|....:||       
  Fly   134 TFEIFLNSCGMTSSANHNAAGYGAPTPSGSYVENT--IIIQYDPYVQEVWDQARKLRC------- 189

  Fly   168 GMPLPVLRQEKGHD--------RNARMRALAAAAAVPALGATSSINQQQRETPRVRIWLELGGPN 224
                      ..:|        |..::..|.|..| ..||            ..::.|:::....
  Fly   190 ----------TWYDFYEKAVTFRPFQVDMLHAVTA-NFLG------------DNLQCWMQIQVGK 231

  Fly   225 G------TGSVEVGVATTLTVRAIV--PGNIGVRVVDCAALDGLGESTQQLLDARGCPIDEQVMP 281
            |      :|.|::|...|: |.||.  .....:.|.:|.|.|| ..:..||:|..||.:..::|.
  Fly   232 GPWASEVSGIVKIGQTMTM-VLAIKDDENKFDMLVRNCVAHDG-KRAPIQLVDQNGCVVRPKIMS 294

  Fly   282 ALH--TQHRPAEEGWSKQHEEDLVERTFAATFPAFKFPDRERLHVSCGVQLCKGKCPTLNCRLKT 344
            ...  ....|:....|            .|.|.||||||...:|..|.:|:|:..||...|    
  Fly   295 KFQKIKNFGPSASVVS------------FAYFQAFKFPDSMNVHFQCVIQVCRYNCPEPKC---- 343

  Fly   345 PPPALSAEQHLARIEVFNSLAVTAPQIEVDRLRYDRRHNMSGEDYAP 391
             .|.|...::            ..|||..:.|         .|:|.|
  Fly   344 -GPGLPGGEY------------GLPQIGANGL---------SEEYGP 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cyrNP_001285004.1 ZP 82..344 CDD:214579 67/302 (22%)
dylNP_647890.2 ZP 90..345 CDD:214579 68/313 (22%)
PHA03378 <339..494 CDD:223065 11/56 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45473268
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR46560
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.