DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1575 and IPI1

DIOPT Version :9

Sequence 1:NP_001285003.1 Gene:CG1575 / 31731 FlyBaseID:FBgn0029999 Length:637 Species:Drosophila melanogaster
Sequence 2:NP_011953.1 Gene:IPI1 / 856485 SGDID:S000001127 Length:334 Species:Saccharomyces cerevisiae


Alignment Length:343 Identity:78/343 - (22%)
Similarity:124/343 - (36%) Gaps:90/343 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 KKNLRAEKAKVKLK-GAKLPKGLNVTKTDFKVRKIEIREQLKESSYSETGQRQFNLKETLSRLKH 69
            :|..:.:..:.||| |....|..|.|.|.|..:.|.||.|       ...|...:|.:.|:.|||
Yeast     7 QKQKKQDFLRKKLKVGKPKEKARNATDTSFVSKTISIRNQ-------HLDQNPHDLTKRLTLLKH 64

  Fly    70 HSVKFR----TDAQRNVRDSLKSGNADHLIGHLNELF----QGIAAGALDME---GSARKESFKT 123
            |::..|    |..|:::...:||.....|:.....|.    |.:..|.:|:.   ||...|..|.
Yeast    65 HNINVRKETLTTFQKSIPSIIKSRLMTPLLTQSIPLICDESQQVRQGLIDLVDEIGSHDAEILKL 129

  Fly   124 LDVLLEALQPQAVAPFFHVIATYLRCAMTHVLPAIQEDSLLMLDVLLLRVPPAFLAERSASTIIG 188
                           ..::...|:..||||::..||.||...|..||.......:.:.....:.|
Yeast   130 ---------------HCNIFVLYINMAMTHIVTQIQADSTKFLSHLLKYCGDEVVRKSWVKLLNG 179

  Fly   189 NF--IDMISRARHDNERSNRTLTLNLSQGKQTTVKWRTKVLIRLQQILSTLV------------- 238
            .|  :......::|        :.::.|.|:...|:   |.|.| ..|.|||             
Yeast   180 VFGVLGWGQVGKND--------SASIVQTKKRNAKY---VTIHL-NALYTLVEYGCQDERARSDG 232

  Fly   239 -TSKTPK-SAAARVVHFEEMRPQYYNVLCPVRHDNRNLHAILNESKL---TAEG----------- 287
             |::|.: |...|..:.....||      |..|    |.....|.|:   |:.|           
Yeast   233 DTAETTEDSGTLRNPYLIPDYPQ------PFEH----LKLFTRELKVQDATSSGVNATLLSLATQ 287

  Fly   288 ---TQLHTYVEQLLPLLQ 302
               |:...::||.||:::
Yeast   288 DIDTRKAVFIEQFLPIVR 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1575NP_001285003.1 Ipi1_N 134..234 CDD:289130 21/101 (21%)
IPI1NP_011953.1 Ipi1_N 125..216 CDD:403521 23/117 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157343353
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2149
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003415
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_105039
Panther 1 1.100 - - LDO PTHR16056
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R614
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.860

Return to query results.
Submit another query.