DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1575 and AT4G04680

DIOPT Version :9

Sequence 1:NP_001285003.1 Gene:CG1575 / 31731 FlyBaseID:FBgn0029999 Length:637 Species:Drosophila melanogaster
Sequence 2:NP_567269.2 Gene:AT4G04680 / 825801 AraportID:AT4G04680 Length:261 Species:Arabidopsis thaliana


Alignment Length:240 Identity:52/240 - (21%)
Similarity:81/240 - (33%) Gaps:63/240 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 ESSYSETGQRQFNLKETLSRLKHHSVKFRTDAQRNVRDSLKSGNADHLIGHLNELFQGIAAGALD 111
            |.|...|.::...||:.|.:..|.:.|.|.||...::|.||:..|: |..|...:.|.:....:|
plant    36 EKSGLATSKKGLTLKDLLPQTSHCNAKLRKDALNGLKDLLKNHPAE-LQSHKYAIIQKLRERIMD 99

  Fly   112 MEGSARKESFKTLD-VLLEALQPQAVAPFFHVIATYLRCAMTHVLPAIQEDSLLMLDVLLLRVP- 174
            .:...|...::..: |:|.|.:....:|...::..|:.|||.|.........||.|..|....| 
plant   100 DDSLVRDALYQLFESVILPACKNDNQSPMVSLLMPYISCAMAHSSVECYISQLLPLMFLATTFPD 164

  Fly   175 -----------------------------------PA------FLAERSASTIIGNFIDMISRAR 198
                                               |:      ||....|.|:...|:|......
plant   165 ISMCYLLQILENYKDNKHKLTYFLLIFTRNRNFLFPSIYRFCFFLLNLRAHTMAKGFLDTGQSPS 229

  Fly   199 HDNERSNRTLTLNLSQGK-QTTVKWRTKVLIRLQQILSTLVTSKT 242
            |           ||.||. .||:....|       ::..:..|||
plant   230 H-----------NLGQGSTHTTLDQNVK-------LVKIITESKT 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1575NP_001285003.1 Ipi1_N 134..234 CDD:289130 26/142 (18%)
AT4G04680NP_567269.2 HEAT repeat 52..76 CDD:293787 7/23 (30%)
HEAT repeat 86..118 CDD:293787 4/31 (13%)
HEAT repeat 127..151 CDD:293787 6/23 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2149
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1285836at2759
OrthoFinder 1 1.000 - - FOG0003415
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_105039
Panther 1 1.100 - - O PTHR16056
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.820

Return to query results.
Submit another query.