DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment UbcE2H and UBC8

DIOPT Version :9

Sequence 1:NP_572438.1 Gene:UbcE2H / 31728 FlyBaseID:FBgn0029996 Length:183 Species:Drosophila melanogaster
Sequence 2:NP_010904.2 Gene:UBC8 / 856704 SGDID:S000000738 Length:218 Species:Saccharomyces cerevisiae


Alignment Length:182 Identity:90/182 - (49%)
Similarity:124/182 - (68%) Gaps:4/182 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 SAGKRRMDNDVIKLIESKHEVTILG-GLNEFHVKFFGPTETPYEGGVWKVRVYLPDNYPFKSPSI 68
            |:.|||::.||:||:.|.|:|.::. .:.||||||.||.:||||.|||::.|.||||||:|||||
Yeast     2 SSSKRRIETDVMKLLMSDHQVDLINDSMQEFHVKFLGPKDTPYENGVWRLHVELPDNYPYKSPSI 66

  Fly    69 GFVNKIYHPNIDESSGTVCLDVINQAWTALYDLSNIFESFLPQLLTYPNPVDPLNRDAAALYLHE 133
            ||||||:|||||.:||::||||||..|:.||||.||.|..:|.||..||..||||.:||.|.|.:
Yeast    67 GFVNKIFHPNIDIASGSICLDVINSTWSPLYDLINIVEWMIPGLLKEPNGSDPLNNEAATLQLRD 131

  Fly   134 PEEYHRKVADYVQRYATEDALR---AAQQERESSDSESSMSDYSEDEARDME 182
            .:.|..|:.:|:.:|||::..:   ....:.:.|||...:.:...|...||:
Yeast   132 KKLYEEKIKEYIDKYATKEKYQQMFGGDNDSDDSDSGGDLQEEDSDSDEDMD 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UbcE2HNP_572438.1 COG5078 1..149 CDD:227410 81/144 (56%)
UBC8NP_010904.2 COG5078 2..149 CDD:227410 83/146 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157342033
Domainoid 1 1.000 158 1.000 Domainoid score I876
eggNOG 1 0.900 - - E1_KOG0416
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H103894
Inparanoid 1 1.050 193 1.000 Inparanoid score I893
Isobase 1 0.950 - 0 Normalized mean entropy S325
OMA 1 1.010 - - QHG54493
OrthoFinder 1 1.000 - - FOG0003525
OrthoInspector 1 1.000 - - oto99706
orthoMCL 1 0.900 - - OOG6_102420
Panther 1 1.100 - - LDO PTHR24068
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2322
SonicParanoid 1 1.000 - - X2404
TreeFam 1 0.960 - -
1615.740

Return to query results.
Submit another query.