DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment UbcE2H and UBC5

DIOPT Version :9

Sequence 1:NP_572438.1 Gene:UbcE2H / 31728 FlyBaseID:FBgn0029996 Length:183 Species:Drosophila melanogaster
Sequence 2:NP_564817.2 Gene:UBC5 / 842683 AraportID:AT1G63800 Length:185 Species:Arabidopsis thaliana


Alignment Length:177 Identity:94/177 - (53%)
Similarity:128/177 - (72%) Gaps:8/177 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSSPSAGKRRMDNDVIKLIESKHEVTILG-GLNEFHVKFFGPTETPYEGGVWKVRVYLPDNYPFK 64
            |||||   :|.:.|::||:.|.::|.::. |:.||.|:|.||.::.|||||||:||.|||.||:|
plant     1 MSSPS---KRREMDLMKLMMSDYKVEMINDGMQEFFVEFSGPKDSIYEGGVWKIRVELPDAYPYK 62

  Fly    65 SPSIGFVNKIYHPNIDESSGTVCLDVINQAWTALYDLSNIFESFLPQLLTYPNPVDPLNRDAAAL 129
            |||:||:.||||||:||.||:||||||||.|:.::||.|:||:||||||.||||.||||.:||||
plant    63 SPSVGFITKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFETFLPQLLLYPNPSDPLNGEAAAL 127

  Fly   130 YLHEPEEYHRKVADYVQRYATEDALRAAQQERESSDSESSMSDYSED 176
            .:.:...|.::|.:|.::||..    .|..|..|||.|.|..:|:.|
plant   128 MMRDRPTYEQRVKEYCEKYAKP----RADTEEMSSDDEMSEDEYASD 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UbcE2HNP_572438.1 COG5078 1..149 CDD:227410 83/148 (56%)
UBC5NP_564817.2 UQ_con 7..143 CDD:365926 77/135 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 168 1.000 Domainoid score I1176
eggNOG 1 0.900 - - E1_KOG0416
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H103894
Inparanoid 1 1.050 195 1.000 Inparanoid score I1346
OMA 1 1.010 - - QHG54493
OrthoDB 1 1.010 - - D1301162at2759
OrthoFinder 1 1.000 - - FOG0003525
OrthoInspector 1 1.000 - - otm3016
orthoMCL 1 0.900 - - OOG6_102420
Panther 1 1.100 - - O PTHR24068
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2404
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.840

Return to query results.
Submit another query.