DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment UbcE2H and UBC4

DIOPT Version :10

Sequence 1:NP_572438.1 Gene:UbcE2H / 31728 FlyBaseID:FBgn0029996 Length:183 Species:Drosophila melanogaster
Sequence 2:NP_568589.1 Gene:UBC4 / 834136 AraportID:AT5G41340 Length:187 Species:Arabidopsis thaliana


Alignment Length:181 Identity:95/181 - (52%)
Similarity:129/181 - (71%) Gaps:8/181 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSSPSAGKRRMDNDVIKLIESKHEV-TILGGLNEFHVKFFGPTETPYEGGVWKVRVYLPDNYPFK 64
            |||||   :|.:.|::||:.|.::| ||..|:.||:|:|.||.::.|:|||||:||.|||.||:|
plant     1 MSSPS---KRREMDMMKLMMSDYKVETINDGMQEFYVEFNGPKDSLYQGGVWKIRVELPDAYPYK 62

  Fly    65 SPSIGFVNKIYHPNIDESSGTVCLDVINQAWTALYDLSNIFESFLPQLLTYPNPVDPLNRDAAAL 129
            |||:||:.||||||:||.||:||||||||.|:.::||.|:||:||||||.||||.||||.:||||
plant    63 SPSVGFITKIYHPNVDELSGSVCLDVINQTWSPMFDLVNVFETFLPQLLLYPNPSDPLNGEAAAL 127

  Fly   130 YLHEPEEYHRKVADYVQRYATEDALRAAQQERESSDSESSMSDYSEDEARD 180
            .:.:...|.::|.:|.::||..    ....|.:|||.|.|..:|..|...|
plant   128 MMRDRPAYEQRVKEYCEKYAKP----GEGSEDKSSDEELSEEEYGSDNEDD 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UbcE2HNP_572438.1 UBCc_UBE2H 9..145 CDD:467417 78/136 (57%)
UBC4NP_568589.1 UBCc_UBE2H 6..143 CDD:467417 78/136 (57%)

Return to query results.
Submit another query.