DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment UbcE2H and CG46338

DIOPT Version :9

Sequence 1:NP_572438.1 Gene:UbcE2H / 31728 FlyBaseID:FBgn0029996 Length:183 Species:Drosophila melanogaster
Sequence 2:NP_524888.1 Gene:CG46338 / 47272 FlyBaseID:FBgn0285962 Length:244 Species:Drosophila melanogaster


Alignment Length:162 Identity:48/162 - (29%)
Similarity:70/162 - (43%) Gaps:51/162 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 KLIESKHEVTILGG----------LNEFHVKFFGPTETPYEGGVWKVRVYLPDNYP-FKS-PSIG 69
            |:|||:.    |.|          |..|.| ||| .:..|...|::..:.|||.:| .|| |||.
  Fly    30 KMIESEK----LSGIYVIPSYANSLQWFGV-FFG-RQGLYAESVFRFTILLPDRFPDDKSLPSII 88

  Fly    70 FVNKIYHPNIDESSGTVCLDVINQAWTALYDLSNIF------ESFLPQLLTY-----PNPVDPL- 122
            |...:.||:       ||      .:|...|:|:.|      |..|.|||.|     .:|:|.: 
  Fly    89 FQQDVIHPH-------VC------PYTHSLDVSHAFPEWRCGEDHLWQLLKYLQVIFSDPLDSIR 140

  Fly   123 --------NRDAAALYLHEPEEYHRKVADYVQ 146
                    |.:||.|.::..|||..:|.:.::
  Fly   141 GIEVDKLKNSEAAELLMNNKEEYVARVQENIK 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UbcE2HNP_572438.1 COG5078 1..149 CDD:227410 48/162 (30%)
CG46338NP_524888.1 UBCc 19..169 CDD:294101 48/157 (31%)
COG5078 24..176 CDD:227410 48/162 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438171
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.