DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment UbcE2H and vih

DIOPT Version :9

Sequence 1:NP_572438.1 Gene:UbcE2H / 31728 FlyBaseID:FBgn0029996 Length:183 Species:Drosophila melanogaster
Sequence 2:NP_648582.1 Gene:vih / 44118 FlyBaseID:FBgn0264848 Length:178 Species:Drosophila melanogaster


Alignment Length:109 Identity:36/109 - (33%)
Similarity:65/109 - (59%) Gaps:3/109 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 GPTETPYEGGVWKVRVYLPDNYPFKSPSIGFVNKIYHPNIDESSGTVCLDVINQAWTALYDLSNI 104
            ||..|.|.|..:::.:..|::||:.:|.:.|:...:|||:| ..|.:|||::...|:||||:..|
  Fly    70 GPRNTVYSGQTYRLSLDFPNSYPYAAPVVKFLTSCFHPNVD-LQGAICLDILKDKWSALYDVRTI 133

  Fly   105 FESFLPQLLTYPNPVDPLNRDAAALYLHEPEEYHRKVADYVQRY 148
            ..| :..||..||...|||..||.:: ::.:||.:.:..:.:::
  Fly   134 LLS-IQSLLGEPNNESPLNAQAAMMW-NDQKEYKKYLDAFYEKH 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UbcE2HNP_572438.1 COG5078 1..149 CDD:227410 36/109 (33%)
vihNP_648582.1 COG5078 31..166 CDD:227410 36/98 (37%)
UQ_con 36..172 CDD:278603 36/104 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438041
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24068
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.