DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment UbcE2H and CG14739

DIOPT Version :9

Sequence 1:NP_572438.1 Gene:UbcE2H / 31728 FlyBaseID:FBgn0029996 Length:183 Species:Drosophila melanogaster
Sequence 2:NP_650151.1 Gene:CG14739 / 41467 FlyBaseID:FBgn0037987 Length:206 Species:Drosophila melanogaster


Alignment Length:180 Identity:75/180 - (41%)
Similarity:106/180 - (58%) Gaps:4/180 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 PSAGKRRMDNDVIKLIESKHEVTILGGLNEFHVKFFGPTETPYEGGVWKVRVYLPDNYPFKSPSI 68
            |.|| ||:|.||.:|:.|.:..|:...:...:|...||..:.||||:|.|.|.:|.:||..:|.:
  Fly    12 PMAG-RRLDRDVNRLLASGYRTTVDDDMTNLNVCLEGPLGSAYEGGIWTVNVTMPQDYPLTAPRV 75

  Fly    69 GFVNKIYHPNIDESSGTVCLDVINQAWTALYDLSNIFESFLPQLLTYPNPVDPLNRDAAALYLHE 133
            .||.||.||||:..:|.||::|:.|||::.|||.||||:||||||.||||.|.||..|||:..|.
  Fly    76 RFVTKILHPNIEFITGLVCMNVLKQAWSSSYDLVNIFETFLPQLLRYPNPHDSLNHRAAAIMKHS 140

  Fly   134 PEEYHRKVADYVQRYATEDAL---RAAQQERESSDSESSMSDYSEDEARD 180
            .:.:...|...::.||....|   :..::..|...|:.|:||...|...|
  Fly   141 EQLFREHVILCMKTYAMPANLPTRQLVEEGLEKRSSDLSLSDLLTDSDDD 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UbcE2HNP_572438.1 COG5078 1..149 CDD:227410 65/144 (45%)
CG14739NP_650151.1 COG5078 12..157 CDD:227410 66/145 (46%)
UQ_con 17..152 CDD:278603 61/134 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442660
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0416
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S325
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1301162at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24068
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.800

Return to query results.
Submit another query.