DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment UbcE2H and Ubc84D

DIOPT Version :10

Sequence 1:NP_572438.1 Gene:UbcE2H / 31728 FlyBaseID:FBgn0029996 Length:183 Species:Drosophila melanogaster
Sequence 2:NP_524260.1 Gene:Ubc84D / 40900 FlyBaseID:FBgn0017456 Length:153 Species:Drosophila melanogaster


Alignment Length:151 Identity:43/151 - (28%)
Similarity:77/151 - (50%) Gaps:11/151 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 AGKRRMDNDVIKLIESKHEVTILGGL---NEFHVKFFG---PTETPYEGGVWKVRVYLPDNYPFK 64
            |..||:..::..|:|:|  ::.|..:   :|..:.:.|   |.:.||..|.:::.:..|..|||.
  Fly     2 AATRRLTRELSDLVEAK--MSTLRNIESSDESLLMWTGLLVPEKAPYNKGAFRIEINFPPQYPFM 64

  Fly    65 SPSIGFVNKIYHPNIDESSGTVCLDVIN-QAWTALYDLSNIFESFLPQLLTYPNPVDPLNRDAAA 128
            .|.|.|..||||||:|| .|.|||.:|: ..|........:.:: |..::..|.|..||..|.|.
  Fly    65 PPKILFKTKIYHPNVDE-KGEVCLPIISTDNWKPTTRTEQVLQA-LVAIVHNPEPEHPLRSDLAE 127

  Fly   129 LYLHEPEEYHRKVADYVQRYA 149
            .::.|.:::.:...::.::.|
  Fly   128 EFVREHKKFMKTAEEFTKKNA 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UbcE2HNP_572438.1 UBCc_UBE2H 9..145 CDD:467417 41/142 (29%)
Ubc84DNP_524260.1 UBCc_UBE2L3 3..149 CDD:467421 42/150 (28%)

Return to query results.
Submit another query.