DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment UbcE2H and Ubc6

DIOPT Version :9

Sequence 1:NP_572438.1 Gene:UbcE2H / 31728 FlyBaseID:FBgn0029996 Length:183 Species:Drosophila melanogaster
Sequence 2:NP_001246916.1 Gene:Ubc6 / 40610 FlyBaseID:FBgn0004436 Length:151 Species:Drosophila melanogaster


Alignment Length:152 Identity:51/152 - (33%)
Similarity:85/152 - (55%) Gaps:10/152 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSSPSAGKRRMDNDVIKLIESKHEVTILGGLNE-----FHVKFFGPTETPYEGGVWKVRVYLPDN 60
            ||:|:  :||:..| .|.::......:.|...:     ::...|||.:||:|.|.:|:.:...:.
  Fly     1 MSTPA--RRRLMRD-FKRLQEDPPTGVSGAPTDNNIMIWNAVIFGPHDTPFEDGTFKLTIEFTEE 62

  Fly    61 YPFKSPSIGFVNKIYHPNIDESSGTVCLDVINQAWTALYDLSNIFESFLPQLLTYPNPVDPLNRD 125
            ||.|.|::.||:|::|||: .:.|.:|||::...|:..||:|.|..| :..||:.|||..|.|..
  Fly    63 YPNKPPTVRFVSKVFHPNV-YADGGICLDILQNRWSPTYDVSAILTS-IQSLLSDPNPNSPANST 125

  Fly   126 AAALYLHEPEEYHRKVADYVQR 147
            ||.||.....||.::|...|::
  Fly   126 AAQLYKENRREYEKRVKACVEQ 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UbcE2HNP_572438.1 COG5078 1..149 CDD:227410 51/152 (34%)
Ubc6NP_001246916.1 UQ_con 8..145 CDD:395127 46/139 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438076
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.