DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment UbcE2H and UbcE2M

DIOPT Version :10

Sequence 1:NP_572438.1 Gene:UbcE2H / 31728 FlyBaseID:FBgn0029996 Length:183 Species:Drosophila melanogaster
Sequence 2:NP_648187.1 Gene:UbcE2M / 38916 FlyBaseID:FBgn0035853 Length:181 Species:Drosophila melanogaster


Alignment Length:140 Identity:40/140 - (28%)
Similarity:66/140 - (47%) Gaps:6/140 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 SAGKRRMDNDVIKLIESKHEVTILGGLNEFHVKF---FGPTETPYEGGVWKVRVYLPDNYPFKSP 66
            ||.:.|:..|:.:|.......|.....|:. :.|   ..|.|..|..|.:.....:..|||.:.|
  Fly    25 SAAQLRIQKDINELNLPNTCATDFPDPNDL-LNFKLIISPDEGFYRDGRFVFNFRVGSNYPHEPP 88

  Fly    67 SIGFVNKIYHPNIDESSGTVCLDVINQAWTALYDLSNIFESFLPQLLTYPNPVDPLNRDAAALYL 131
            .:....::|||||| ..|.|||:::.:.|..:.::::|... |..|...|||.||||::||.:..
  Fly    89 KVKCATQVYHPNID-LDGNVCLNILREDWNPVLNINSIVYG-LQFLFLEPNPEDPLNKEAADVLQ 151

  Fly   132 HEPEEYHRKV 141
            ....::...|
  Fly   152 TNRRQFENNV 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UbcE2HNP_572438.1 UBCc_UBE2H 9..145 CDD:467417 38/136 (28%)
UbcE2MNP_648187.1 UBCc_UBE2F_UBE2M 26..163 CDD:467414 39/139 (28%)

Return to query results.
Submit another query.