powered by:
Protein Alignment UbcE2H and Uev1A
DIOPT Version :9
Sequence 1: | NP_572438.1 |
Gene: | UbcE2H / 31728 |
FlyBaseID: | FBgn0029996 |
Length: | 183 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001286940.1 |
Gene: | Uev1A / 38613 |
FlyBaseID: | FBgn0035601 |
Length: | 145 |
Species: | Drosophila melanogaster |
Alignment Length: | 69 |
Identity: | 15/69 - (21%) |
Similarity: | 37/69 - (53%) |
Gaps: | 2/69 - (2%) |
- Green bases have known domain annotations that are detailed below.
Fly 40 GPTETPYEGGVWKVRVYLPDNYPFKSPSIGFVNKIYHPNIDESSGTVCLDVINQ--AWTALYDLS 102
||..||:|..::.:::...:.||.:.|::.|:.|:....|::::|.|....:.. .|:..|::.
Fly 54 GPPRTPFENRMYSLKIECGERYPDEPPTLRFITKVNINCINQNNGVVDHRSVQMLARWSREYNIK 118
Fly 103 NIFE 106
.:.:
Fly 119 TMLQ 122
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
UbcE2H | NP_572438.1 |
COG5078 |
1..149 |
CDD:227410 |
15/69 (22%) |
Uev1A | NP_001286940.1 |
UBCc |
16..142 |
CDD:214562 |
15/69 (22%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C45438203 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
P |
PTHR24068 |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
2 | 2.030 |
|
Return to query results.
Submit another query.