DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment UbcE2H and CG17030

DIOPT Version :10

Sequence 1:NP_572438.1 Gene:UbcE2H / 31728 FlyBaseID:FBgn0029996 Length:183 Species:Drosophila melanogaster
Sequence 2:NP_647941.1 Gene:CG17030 / 38591 FlyBaseID:FBgn0035584 Length:180 Species:Drosophila melanogaster


Alignment Length:169 Identity:42/169 - (24%)
Similarity:84/169 - (49%) Gaps:14/169 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 GKRRMDNDVIKLIESKHEV---TILGGLNEFHVKFFG---PTETPYEGGVWKVRVYLPDNYPFKS 65
            |.:||:.::..::|.|..:   .:|...|..: |:.|   |...||:.|.:|:.:..|.:||||.
  Fly    11 GPKRMNRELALMLEDKQNLQFRNLLVEPNNIY-KWTGLLMPVAPPYDKGAYKMEIDFPLDYPFKP 74

  Fly    66 PSIGFVNKIYHPNIDESSGTVCLDVIN-QAWTALYDLSNIFESFLPQLLTYPNPVDPLNRDAAAL 129
            |.|....::||.|::| .|.||:.::. :.|.....:..:.:..| ..:..|.|.:..:.:.|..
  Fly    75 PRIHINTRMYHLNVNE-RGQVCVPILEVEHWIPTTRIDQVLQVLL-ATINDPQPENAWHIEMAGE 137

  Fly   130 YLHEPEEYHRKVADYVQRYA----TEDALRAAQQERESS 164
            |.::|..:.:....:||:|:    ||:.|....::|:.:
  Fly   138 YRNDPVRFFKMADAWVQKYSEPRPTEEELAKFARKRKKA 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UbcE2HNP_572438.1 UBCc_UBE2H 9..145 CDD:467417 34/142 (24%)
CG17030NP_647941.1 UBCc_UBE2L3 11..158 CDD:467421 38/149 (26%)

Return to query results.
Submit another query.