DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment UbcE2H and CG10862

DIOPT Version :9

Sequence 1:NP_572438.1 Gene:UbcE2H / 31728 FlyBaseID:FBgn0029996 Length:183 Species:Drosophila melanogaster
Sequence 2:NP_647823.1 Gene:CG10862 / 38437 FlyBaseID:FBgn0035455 Length:354 Species:Drosophila melanogaster


Alignment Length:122 Identity:43/122 - (35%)
Similarity:65/122 - (53%) Gaps:4/122 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 GLNEFH--VKFFGPTETPYEGGVWKVRVYLPDNYPFKSPSIGFVNKIYHPNIDESSGTVCLDVIN 92
            |.|.||  ....||:||.||||.::|.:..|.||||..|.:.|:.|.||.|| ..||.:|||::.
  Fly   234 GDNLFHWVATIPGPSETVYEGGRFRVEIVFPRNYPFYPPYLAFLTKTYHCNI-ALSGRICLDILG 297

  Fly    93 QAWTALYDLSNIFESFLPQLLTYPNPVDPLNRDAAALYLHEPEEYHRKVADYVQRYA 149
            ..|:....:|.:..|.: .||..|||.||:....|.::......:.:...::.::||
  Fly   298 SKWSPALSVSKVLISIM-SLLADPNPHDPMEVSVADVFKGNRALHDKNAREWTKKYA 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UbcE2HNP_572438.1 COG5078 1..149 CDD:227410 41/120 (34%)
CG10862NP_647823.1 COG5078 207..354 CDD:227410 43/122 (35%)
UQ_con 212..349 CDD:278603 41/116 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24068
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.