DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment UbcE2H and CG10862

DIOPT Version :10

Sequence 1:NP_572438.1 Gene:UbcE2H / 31728 FlyBaseID:FBgn0029996 Length:183 Species:Drosophila melanogaster
Sequence 2:NP_647823.1 Gene:CG10862 / 38437 FlyBaseID:FBgn0035455 Length:354 Species:Drosophila melanogaster


Alignment Length:122 Identity:43/122 - (35%)
Similarity:65/122 - (53%) Gaps:4/122 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 GLNEFH--VKFFGPTETPYEGGVWKVRVYLPDNYPFKSPSIGFVNKIYHPNIDESSGTVCLDVIN 92
            |.|.||  ....||:||.||||.::|.:..|.||||..|.:.|:.|.||.|| ..||.:|||::.
  Fly   234 GDNLFHWVATIPGPSETVYEGGRFRVEIVFPRNYPFYPPYLAFLTKTYHCNI-ALSGRICLDILG 297

  Fly    93 QAWTALYDLSNIFESFLPQLLTYPNPVDPLNRDAAALYLHEPEEYHRKVADYVQRYA 149
            ..|:....:|.:..|.: .||..|||.||:....|.::......:.:...::.::||
  Fly   298 SKWSPALSVSKVLISIM-SLLADPNPHDPMEVSVADVFKGNRALHDKNAREWTKKYA 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UbcE2HNP_572438.1 UBCc_UBE2H 9..145 CDD:467417 41/116 (35%)
CG10862NP_647823.1 UBCc_UEV 212..352 CDD:483950 41/119 (34%)

Return to query results.
Submit another query.