DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment UbcE2H and CG16894

DIOPT Version :9

Sequence 1:NP_572438.1 Gene:UbcE2H / 31728 FlyBaseID:FBgn0029996 Length:183 Species:Drosophila melanogaster
Sequence 2:NP_611455.1 Gene:CG16894 / 37280 FlyBaseID:FBgn0034483 Length:266 Species:Drosophila melanogaster


Alignment Length:199 Identity:41/199 - (20%)
Similarity:73/199 - (36%) Gaps:48/199 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 GLNEFHVKFFGPTETPYEGGVWKVRVYLPDNYP--FKSPSIGFVNKIYHPNIDESSGTVCL-DVI 91
            ||:.|.|.|.  ....|.|.|::..:.||:|:|  ...|::.|..::.||:|...:.|:.| ..:
  Fly    43 GLHWFGVIFV--HSGIYAGSVFRFSILLPENFPADISLPTVVFSTEVLHPHICPQNKTLDLAHFL 105

  Fly    92 NQ-------AWTALYDLSNIFESFLPQLLTYPNPVDPL-------NRDAAALYLHEPEEYHRKVA 142
            |:       .|..|..:..||......:.|..:....|       |.:|..:......||.::|.
  Fly   106 NEWRKDEHHIWHVLRYIQAIFADPEGSICTGQSSSGDLVIMDEVRNMNALNMLAKSRPEYIKRVQ 170

  Fly   143 D---------------------YVQRYATEDALRAAQQERESSDSESSMSDYSE--------DEA 178
            :                     .|:.|..|..|:...|.:.....|::..|.|:        |.:
  Fly   171 EQAILSRNLIYDRPPTEDPHYIIVEPYCAERHLKFMDQLKSPCWKEATSMDCSQPSEYLGHIDSS 235

  Fly   179 RDME 182
            |.::
  Fly   236 RQLD 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UbcE2HNP_572438.1 COG5078 1..149 CDD:227410 32/156 (21%)
CG16894NP_611455.1 COG5078 20..176 CDD:227410 31/134 (23%)
UBCc 23..173 CDD:294101 31/131 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438173
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.