Sequence 1: | NP_572438.1 | Gene: | UbcE2H / 31728 | FlyBaseID: | FBgn0029996 | Length: | 183 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_611455.1 | Gene: | CG16894 / 37280 | FlyBaseID: | FBgn0034483 | Length: | 266 | Species: | Drosophila melanogaster |
Alignment Length: | 199 | Identity: | 41/199 - (20%) |
---|---|---|---|
Similarity: | 73/199 - (36%) | Gaps: | 48/199 - (24%) |
- Green bases have known domain annotations that are detailed below.
Fly 30 GLNEFHVKFFGPTETPYEGGVWKVRVYLPDNYP--FKSPSIGFVNKIYHPNIDESSGTVCL-DVI 91
Fly 92 NQ-------AWTALYDLSNIFESFLPQLLTYPNPVDPL-------NRDAAALYLHEPEEYHRKVA 142
Fly 143 D---------------------YVQRYATEDALRAAQQERESSDSESSMSDYSE--------DEA 178
Fly 179 RDME 182 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
UbcE2H | NP_572438.1 | COG5078 | 1..149 | CDD:227410 | 32/156 (21%) |
CG16894 | NP_611455.1 | COG5078 | 20..176 | CDD:227410 | 31/134 (23%) |
UBCc | 23..173 | CDD:294101 | 31/131 (24%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C45438173 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.840 |