DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment UbcE2H and ube2h

DIOPT Version :9

Sequence 1:NP_572438.1 Gene:UbcE2H / 31728 FlyBaseID:FBgn0029996 Length:183 Species:Drosophila melanogaster
Sequence 2:NP_958897.1 Gene:ube2h / 368425 ZFINID:ZDB-GENE-030616-67 Length:183 Species:Danio rerio


Alignment Length:183 Identity:142/183 - (77%)
Similarity:162/183 - (88%) Gaps:0/183 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSSPSAGKRRMDNDVIKLIESKHEVTILGGLNEFHVKFFGPTETPYEGGVWKVRVYLPDNYPFKS 65
            |||||.||||||.||:||||||||||||.|||||.|||:||..||||||||||||.|||.|||||
Zfish     1 MSSPSPGKRRMDTDVVKLIESKHEVTILSGLNEFVVKFYGPQGTPYEGGVWKVRVDLPDKYPFKS 65

  Fly    66 PSIGFVNKIYHPNIDESSGTVCLDVINQAWTALYDLSNIFESFLPQLLTYPNPVDPLNRDAAALY 130
            |||||:|||:||||||:|||||||||||.|||||||:|||||||||||.||||:||||.||||:|
Zfish    66 PSIGFMNKIFHPNIDEASGTVCLDVINQTWTALYDLTNIFESFLPQLLAYPNPIDPLNGDAAAMY 130

  Fly   131 LHEPEEYHRKVADYVQRYATEDALRAAQQERESSDSESSMSDYSEDEARDMEL 183
            ||.||:|.:|:.:|:|:||||:||:..::....|.|||||||:|||||:||||
Zfish   131 LHRPEDYKQKIKEYIQKYATEEALKEQEEGPGDSSSESSMSDFSEDEAQDMEL 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UbcE2HNP_572438.1 COG5078 1..149 CDD:227410 119/147 (81%)
ube2hNP_958897.1 COG5078 1..149 CDD:227410 119/147 (81%)
UQ_con 31..145 CDD:278603 91/113 (81%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170576267
Domainoid 1 1.000 208 1.000 Domainoid score I2819
eggNOG 1 0.900 - - E1_KOG0416
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H103894
Inparanoid 1 1.050 304 1.000 Inparanoid score I2640
OMA 1 1.010 - - QHG54493
OrthoDB 1 1.010 - - D1301162at2759
OrthoFinder 1 1.000 - - FOG0003525
OrthoInspector 1 1.000 - - oto41662
orthoMCL 1 0.900 - - OOG6_102420
Panther 1 1.100 - - LDO PTHR24068
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2322
SonicParanoid 1 1.000 - - X2404
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1716.800

Return to query results.
Submit another query.