DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment UbcE2H and CG3473

DIOPT Version :9

Sequence 1:NP_572438.1 Gene:UbcE2H / 31728 FlyBaseID:FBgn0029996 Length:183 Species:Drosophila melanogaster
Sequence 2:NP_001285937.1 Gene:CG3473 / 34849 FlyBaseID:FBgn0028913 Length:151 Species:Drosophila melanogaster


Alignment Length:97 Identity:41/97 - (42%)
Similarity:63/97 - (64%) Gaps:2/97 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 FHVKFFGPTETPYEGGVWKVRVYLPDNYPFKSPSIGFVNKIYHPNIDESSGTVCLDVINQAWTAL 98
            |||...||.::|:|||.:|:.::||::||.|:|.:.|:.||:|||||. .|.:|||::...|:..
  Fly    35 FHVLVTGPKDSPFEGGNFKLELFLPEDYPMKAPKVRFLTKIFHPNIDR-VGRICLDILKDKWSPA 98

  Fly    99 YDLSNIFESFLPQLLTYPNPVDPLNRDAAALY 130
            ..:..:..| :..||:.|||.|||..|.|.|:
  Fly    99 LQIRTVLLS-IQALLSAPNPDDPLANDVAELW 129

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UbcE2HNP_572438.1 COG5078 1..149 CDD:227410 41/97 (42%)
CG3473NP_001285937.1 UBCc 3..151 CDD:294101 41/97 (42%)
COG5078 7..149 CDD:227410 41/97 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438132
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24068
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.