DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment UbcE2H and morgue

DIOPT Version :10

Sequence 1:NP_572438.1 Gene:UbcE2H / 31728 FlyBaseID:FBgn0029996 Length:183 Species:Drosophila melanogaster
Sequence 2:NP_608833.1 Gene:morgue / 33648 FlyBaseID:FBgn0027609 Length:491 Species:Drosophila melanogaster


Alignment Length:119 Identity:36/119 - (30%)
Similarity:61/119 - (51%) Gaps:3/119 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 NEFHVKFFGPTETPYEGGVWKVRVYLPDNYPFKSPSIGFVNKIYHPNIDESSGTVCLDVINQ-AW 95
            |.:.....||..:|||||.:.:.:|.|:.||...|::.|:.||.|||:.. .|.|.:|:..| .|
  Fly   367 NYWQATILGPPGSPYEGGKFFLFIYFPERYPMTPPTVRFLTKILHPNVSR-HGDVGIDIFQQHNW 430

  Fly    96 TALYDLSNIFESFLPQLLTYPNPVDPLNRDAAALYLHEPEEYHRKVADYVQRYA 149
            :...:::.:..| :..|||.|.....:..:...:|.||.|.:.:.|..:..:||
  Fly   431 SLALNVAKVLLS-VQSLLTDPYTEVCMEPELGYIYEHERERFEQLVRAWTWKYA 483

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UbcE2HNP_572438.1 UBCc_UBE2H 9..145 CDD:467417 34/113 (30%)
morgueNP_608833.1 PLN03029 <104..170 CDD:215544
F-box_SF 234..265 CDD:438852
UEV_Morgue-like 337..483 CDD:467436 34/117 (29%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.