DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment UbcE2H and CG40045

DIOPT Version :9

Sequence 1:NP_572438.1 Gene:UbcE2H / 31728 FlyBaseID:FBgn0029996 Length:183 Species:Drosophila melanogaster
Sequence 2:NP_001036640.1 Gene:CG40045 / 3355079 FlyBaseID:FBgn0058045 Length:168 Species:Drosophila melanogaster


Alignment Length:153 Identity:44/153 - (28%)
Similarity:71/153 - (46%) Gaps:31/153 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 DNDVIKLIESKHEVTILGGLNEFHVKFFGPTETPYEGGVWKVRVYLPDNYPFKSPSIGFVNKIYH 76
            :||:.:                :.|...||.:|.||||.:|..:|.|..||.:.|.:.||.:|:|
  Fly    32 ENDIFR----------------WEVLIIGPPDTLYEGGFFKAHLYFPKEYPLRPPRMKFVTEIWH 80

  Fly    77 PNIDESSGTVCLDVI-------------NQAWTALYDLSNIFESFLPQLLTYPNPVDPLNRDAAA 128
            ||| |.:|.||:.::             ::.|..::.:..|..|.: .:|..||...|.|.|||.
  Fly    81 PNI-EKNGDVCISILHEPGDDKWGYEKASERWLPVHTVETILISVI-SMLADPNDESPANVDAAK 143

  Fly   129 LYLHEPEEYHRKVADYVQRYATE 151
            .:.....::.||||..|::...|
  Fly   144 EWRESYTDFKRKVARCVRKSQEE 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UbcE2HNP_572438.1 COG5078 1..149 CDD:227410 43/149 (29%)
CG40045NP_001036640.1 UQ_con 10..160 CDD:395127 42/145 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438106
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.