DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment UbcE2H and ubc8

DIOPT Version :9

Sequence 1:NP_572438.1 Gene:UbcE2H / 31728 FlyBaseID:FBgn0029996 Length:183 Species:Drosophila melanogaster
Sequence 2:NP_596617.1 Gene:ubc8 / 2540738 PomBaseID:SPBC211.07c Length:184 Species:Schizosaccharomyces pombe


Alignment Length:178 Identity:100/178 - (56%)
Similarity:129/178 - (72%) Gaps:4/178 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSSPSAGKRRMDNDVIKLIESKHEVTILG-GLNEFHVKFFGPTETPYEGGVWKVRVYLPDNYPFK 64
            ||||   :||::.||:||:.|.:|||::. .:.||:|:|.||:||||.||:|||.|.||..||:|
pombe     1 MSSP---RRRIETDVMKLLMSDYEVTLVNDNMQEFYVRFHGPSETPYSGGIWKVHVELPSEYPWK 62

  Fly    65 SPSIGFVNKIYHPNIDESSGTVCLDVINQAWTALYDLSNIFESFLPQLLTYPNPVDPLNRDAAAL 129
            ||||||||:|:||||||.||:||||||||.|:.::|:.||||.||||||.|||..||||.:||||
pombe    63 SPSIGFVNRIFHPNIDELSGSVCLDVINQTWSPMFDMINIFEVFLPQLLRYPNASDPLNGEAAAL 127

  Fly   130 YLHEPEEYHRKVADYVQRYATEDALRAAQQERESSDSESSMSDYSEDE 177
            .|.||..|:.||.||:.|||.::.......:....|:.||:...|.||
pombe   128 LLREPNTYYAKVRDYIARYANKEDADITLNDSSDDDTMSSIDTESGDE 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UbcE2HNP_572438.1 COG5078 1..149 CDD:227410 92/148 (62%)
ubc8NP_596617.1 COG5078 1..149 CDD:227410 94/150 (63%)
UQ_con 11..143 CDD:278603 84/131 (64%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 173 1.000 Domainoid score I879
eggNOG 1 0.900 - - E1_KOG0416
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H103894
Inparanoid 1 1.050 208 1.000 Inparanoid score I965
OMA 1 1.010 - - QHG54493
OrthoFinder 1 1.000 - - FOG0003525
OrthoInspector 1 1.000 - - oto101362
orthoMCL 1 0.900 - - OOG6_102420
Panther 1 1.100 - - LDO PTHR24068
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2322
SonicParanoid 1 1.000 - - X2404
TreeFam 1 0.960 - -
1413.860

Return to query results.
Submit another query.