DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment UbcE2H and ubc-8

DIOPT Version :9

Sequence 1:NP_572438.1 Gene:UbcE2H / 31728 FlyBaseID:FBgn0029996 Length:183 Species:Drosophila melanogaster
Sequence 2:NP_500245.3 Gene:ubc-8 / 190802 WormBaseID:WBGene00006705 Length:216 Species:Caenorhabditis elegans


Alignment Length:197 Identity:111/197 - (56%)
Similarity:140/197 - (71%) Gaps:23/197 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SSPSAGKRRMDNDVIKLIESKHEVTILGGLNEFHVKFFGPTETPYEGGVWKVRVYLPDNYPFKSP 66
            |:.:.||||:|.||:|||...|||.|:.|.:||.|:|.||.:|.||.|||::||.:||.||||||
 Worm     3 SATAIGKRRIDCDVVKLISHNHEVQIVNGCSEFIVRFHGPKDTAYENGVWRIRVDMPDKYPFKSP 67

  Fly    67 SIGFVNKIYHPNIDESSGTVCLDVINQAWTALYDLSNIFESFLPQLLTYPNPVDPLNRDAAALYL 131
            ||||:|||:||||||:|||||||||||||||||||:|||::||||||||||..||||.:||.||:
 Worm    68 SIGFLNKIFHPNIDEASGTVCLDVINQAWTALYDLTNIFDTFLPQLLTYPNAADPLNGEAARLYI 132

  Fly   132 HEPEEYHRKVADYVQRYATEDALRAAQ---------------------QERESSDSESSMSDYSE 175
            |:||||.|...:||.|:|:|.  ||.:                     .:.:..:|.||||::.|
 Worm   133 HKPEEYRRTCREYVMRFASEH--RAIEGCSPGNAYSISSTPSEHYDGHPQDDDDESCSSMSEFDE 195

  Fly   176 DE 177
            .|
 Worm   196 SE 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UbcE2HNP_572438.1 COG5078 1..149 CDD:227410 100/146 (68%)
ubc-8NP_500245.3 UQ_con 15..146 CDD:365926 91/130 (70%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160157561
Domainoid 1 1.000 188 1.000 Domainoid score I1972
eggNOG 1 0.900 - - E1_KOG0416
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H103894
Inparanoid 1 1.050 225 1.000 Inparanoid score I2237
Isobase 1 0.950 - 0 Normalized mean entropy S325
OMA 1 1.010 - - QHG54493
OrthoDB 1 1.010 - - D1301162at2759
OrthoFinder 1 1.000 - - FOG0003525
OrthoInspector 1 1.000 - - oto19216
orthoMCL 1 0.900 - - OOG6_102420
Panther 1 1.100 - - LDO PTHR24068
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2322
SonicParanoid 1 1.000 - - X2404
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1817.750

Return to query results.
Submit another query.